mirror of
https://github.com/golang/go.git
synced 2026-04-18 18:00:41 +00:00
[dev.simd] all: merge master (7a1679d) into dev.simd
Conflicts: - src/cmd/compile/internal/amd64/ssa.go - src/cmd/compile/internal/ssa/rewriteAMD64.go - src/internal/buildcfg/exp.go - src/internal/cpu/cpu.go - src/internal/cpu/cpu_x86.go - src/internal/goexperiment/flags.go Merge List: + 2025-08-047a1679d7aecmd/compile: move s390x over to new bounds check strategy + 2025-08-0495693816a5cmd/compile: move riscv64 over to new bounds check strategy + 2025-08-04d7bd7773ebgo/parser: remove safePos + 2025-08-044b6cbc377fcmd/cgo/internal/test: use (syntactic) constant for C array bound + 2025-08-03b2960e3580cmd/internal/obj/loong64: add {V,XV}{BITCLR/BITSET/BITREV}[I].{B/H/W/D} instructions support + 2025-08-03abeeef1c08cmd/compile/internal/test: fix typo in comments + 2025-08-03d44749b65bcmd/internal/obj/loong64: add [X]VLDREPL.{B/H/W/D} instructions support + 2025-08-03d6beda863eruntime: add reference to debugPinnerV1 + 2025-08-014ab1aec007cmd/go: modload should use a read-write lock to improve concurrency + 2025-08-01e666972a67runtime: deduplicate Windows stdcall + 2025-08-01ef40549786runtime,syscall: move loadlibrary and getprocaddress to syscall + 2025-08-01336931a4cacmd/go: use os.Rename to move files on Windows + 2025-08-01eef5f8d930cmd/compile: enforce that locals are always accessed with SP base register + 2025-08-01e071617222cmd/compile: optimize multiplication rules on loong64 + 2025-07-31eb7f515c4dcmd/compile: use generated loops instead of DUFFZERO on amd64 + 2025-07-31c0ee2fd4e3cmd/go: explicitly reject module paths "go" and "toolchain" + 2025-07-30a4d99770c0runtime/metrics: add cleanup and finalizer queue metrics + 2025-07-3070a2ff7648runtime: add cgo call benchmark + 2025-07-3069338a335acmd/go/internal/gover: fix ModIsPrerelease for toolchain versions + 2025-07-30cedf63616acmd/compile: add floating point min/max intrinsics on s390x + 2025-07-3082a1921c3ball: remove redundant Swiss prefixes + 2025-07-302ae059ccafall: remove GOEXPERIMENT=swissmap + 2025-07-30cc571dab91cmd/compile: deduplicate instructions when rewrite func results + 2025-07-302174a7936ccrypto/tls: use standard chacha20-poly1305 cipher suite names + 2025-07-308330fb48a6cmd/compile: move mips32 over to new bounds check strategy + 2025-07-309f9d7b50e8cmd/compile: move mips64 over to new bounds check strategy + 2025-07-305216fd570ecmd/compile: move loong64 over to new bounds check strategy + 2025-07-3089a0af86b8cmd/compile: allow ops to specify clobbering input registers + 2025-07-305e94d72158cmd/compile: simplify zerorange on arm64 + 2025-07-308cd85e602acmd/compile: check domination of loop return in both controls + 2025-07-30cefaed0de0reflect: fix noswiss builder + 2025-07-303aa1b00081regexp: fix compiling alternate patterns of different fold case literals + 2025-07-30b1e933d955cmd/compile: avoid extending when already sufficiently masked on loong64 + 2025-07-29880ca333d7cmd/compile: removing log2uint32 function + 2025-07-291513661dc3cmd/compile: simplify logX implementations + 2025-07-29bd94ae8903cmd/compile: use unsigned power-of-two detector for unsigned mod + 2025-07-29f3582fc80ecmd/compile: add unsigned power-of-two detector + 2025-07-29f7d167fe71internal/abi: move direct/indirect flag from Kind to TFlag + 2025-07-29e0b07dc22eos/exec: fix incorrect expansion of "", "." and ".." in LookPath + 2025-07-2925816d401cinternal/goexperiment: delete RangeFunc goexperiment + 2025-07-297961bf71f8internal/goexperiment: delete CacheProg goexperiment + 2025-07-29e15a14c4ddsync: remove synchashtriemap GOEXPERIMENT + 2025-07-297dccd6395ccmd/compile: move arm32 over to new bounds check strategy + 2025-07-29d79405a344runtime: only deduct assist credit for arenas during GC + 2025-07-2919a086f716cmd/go/internal/telemetrystats: count goexperiments + 2025-07-29aa95ab8215image: fix formatting of godoc link + 2025-07-294c854b7a3ecrypto/elliptic: change a variable name that have the same name as keywords + 2025-07-28b10eb1d042cmd/compile: simplify zerorange on amd64 + 2025-07-28f8eae7a3c3os/user: fix tests to pass on non-english Windows + 2025-07-280984264471internal/poll: remove msg field from Windows' poll.operation + 2025-07-28d7b4114346internal/poll: remove rsan field from Windows' poll.operation + 2025-07-28361b1ab41finternal/poll: remove sa field from Windows' poll.operation + 2025-07-289b6bd64e46internal/poll: remove qty and flags fields from Windows' poll.operation + 2025-07-28cd3655a824internal/runtime/maps: fix spelling errors in comments + 2025-07-28d5dc36af45runtime: remove openbsd/mips64 related code + 2025-07-2864ba72474derrors: omit redundant nil check in type assertion for Join + 2025-07-28e151db3e06all: omit unnecessary type conversions + 2025-07-284569255f8ccmd/compile: cleanup SelectN rules by indexing into args + 2025-07-2894645d2413cmd/compile: rewrite cmov(x, x, cond) into x + 2025-07-2810c5cf68d4net/http: add proper panic message + 2025-07-2846b5839231test/codegen: fix failing condmove wasm tests + 2025-07-2898f301cf68runtime,syscall: move SyscallX implementations from runtime to syscall + 2025-07-28c7ed3a1c5ainternal/runtime/syscall/windows: factor out code from runtime + 2025-07-28e81eac19d3hash/crc32: fix incorrect checksums with avx512+race + 2025-07-256fbad4be75cmd/compile: remove no-longer-necessary call to calculateDepths + 2025-07-255045fdd8ffcmd/compile: fix containsUnavoidableCall computation + 2025-07-25d28b27cd8ego/types, types2: use nil to represent incomplete explicit aliases + 2025-07-257b53d8d06ecmd/compile/internal/types2: add loaded state between loader calls and constraint expansion + 2025-07-25374e3be2ebos/user: user random name for the test user account + 2025-07-251aa154621druntime: rename scanobject to scanObject + 2025-07-2541b429881aruntime: duplicate scanobject in greentea and non-greentea files + 2025-07-25aeb256e98acmd/compile: remove unused arg from gorecover + 2025-07-2508376e1a9cruntime: iterate through inlinings when processing recover() + 2025-07-25c76c3abc54encoding/json: fix truncated Token error regression in goexperiment.jsonv2 + 2025-07-25ebdbfccd98encoding/json/jsontext: preserve buffer capacity in Encoder.Reset + 2025-07-2591c4f0ccd5reflect: avoid a bounds check in stack-constrained code + 2025-07-243636ced112encoding/json: fix extra data regression under goexperiment.jsonv2 + 2025-07-24a6eec8bdc7encoding/json: reduce error text regressions under goexperiment.jsonv2 + 2025-07-240fa88dec1etime: remove redundant uint32 conversion in split + 2025-07-24ada30b8248internal/buildcfg: add ability to get GORISCV64 variable in GOGOARCH + 2025-07-246f6c6c5782cmd/internal/obj: rip out argp adjustment for wrapper frames + 2025-07-247b50024330runtime: detect successful recovers differently + 2025-07-247b9de668bdunicode/utf8: skip ahead during ascii runs in Valid/ValidString + 2025-07-24076eae436ecmd/compile: move amd64 and 386 over to new bounds check strategy + 2025-07-24f703dc5befcmd/compile: add missing StringLen rule in prove + 2025-07-24394d0bee8dcmd/compile: move arm64 over to new bounds check strategy + 2025-07-243024785b92cmd/compile,runtime: remember idx+len for bounds check failure with less code + 2025-07-24741a19ab41runtime: move bounds check constants to internal/abi + 2025-07-24ce05ad448fcmd/compile: rewrite condselects into doublings and halvings + 2025-07-24fcd28070fecmd/compile: add opt branchelim to rewrite some CondSelect into math + 2025-07-24f32cf8e4b0cmd/compile: learn transitive proofs for safe unsigned subs + 2025-07-24d574856482cmd/compile: learn transitive proofs for safe negative signed adds + 2025-07-241a72920f09cmd/compile: learn transitive proofs for safe positive signed adds + 2025-07-24e5f202bb60cmd/compile: learn transitive proofs for safe unsigned adds + 2025-07-24bd80f74bc1cmd/compile: fold shift through AND for slice operations + 2025-07-245c45fe1385internal/runtime/syscall: rename to internal/runtime/syscall/linux + 2025-07-24592c2db868cmd/compile: improve loopRotate to handle nested loops + 2025-07-24dcb479c2f9cmd/compile: optimize slice bounds checking with SUB/SUBconst comparisons + 2025-07-24f11599b0b9internal/poll: remove handle field from Windows' poll.operation + 2025-07-24f7432e0230internal/poll: remove fd field from Windows' poll.operation + 2025-07-24e84ed38641runtime: add benchmark for small-size memmory operation + 2025-07-2418dbe5b941hash/crc32: add AVX512 IEEE CRC32 calculation + 2025-07-24c641900f72cmd/compile: prefer base.Fatalf to panic in dwarfgen + 2025-07-24d71d8aeafdcmd/internal/obj/s390x: add MVCLE instruction + 2025-07-24b6cf1d94dcruntime: optimize memclr on mips64x + 2025-07-24a8edd99479runtime: improvement in memclr for s390x + 2025-07-24bd04f65511internal/runtime/exithook: fix a typo + 2025-07-245c8624a396cmd/internal/goobj: make error output clear + 2025-07-2444d73dfb4ecmd/go/internal/doc: clean up after merge with cmd/internal/doc + 2025-07-24bd446662ddcmd/internal/doc: merge with cmd/go/internal/doc + 2025-07-24da8b50c830cmd/doc: delete + 2025-07-246669aa3b14runtime: randomize heap base address + 2025-07-2426338a7f69cmd/compile: use better fatal message for staticValue1 + 2025-07-248587ba272ecmd/cgo: compare malloc return value to NULL instead of literal 0 + 2025-07-24cae45167b7go/types, types2: better error messages for certain type mismatches + 2025-07-242ddf542e4ccmd/compile: use ,ok return idiom for sparsemap.get + 2025-07-246505fcbd0acmd/compile: use generics for sparse map + 2025-07-2414f5eb7812cmd/api: rerun updategolden + 2025-07-2452b6d7f67aruntime: drop NetBSD kernel bug sysmon workaround fixed in NetBSD 9.2 + 2025-07-241ebebf1cc1cmd/go: clean should respect workspaces + 2025-07-246536a93547encoding/json/jsontext: preserve buffer capacity in Decoder.Reset + 2025-07-24efc37e97c0cmd/go: always return the cached path from go tool -n + 2025-07-2398a031193bruntime: check TestUsingVDSO ExitError type assertion + 2025-07-236bb42997c8doc/next: initialize + 2025-07-232696a11a97internal/goversion: update Version to 1.26 + 2025-07-23489868f776cmd/link: scope test to linux & net.sendFile + 2025-07-2271c2bf5513cmd/compile: fix loclist for heap return vars without optimizations + 2025-07-22c74399e7f5net: correct comment for ListenConfig.ListenPacket + 2025-07-224ed9943b26all: go fmt + 2025-07-221aaf7422f1cmd/internal/objabi: remove redundant word in comment + 2025-07-21d5ec0815e6runtime: relax TestMemoryLimitNoGCPercent a bit + 2025-07-21f7cc61e7d7cmd/compile: for arm64 epilog, do SP increment with a single instruction + 2025-07-215dac42363bruntime: fix asan wrapper for riscv64 + 2025-07-21e5502e0959cmd/go: check subcommand properties + 2025-07-192363897932cmd/internal/obj: enable got pcrel itype in fips140 for riscv64 + 2025-07-19e32255fcc0cmd/compile/internal/ssa: restrict architectures for TestDebugLines_74576 + 2025-07-180451816430os: revert the use of AddCleanup to close files and roots + 2025-07-1834b70684bago/types: infer correct type for y in append(bytes, y...) + 2025-07-1766536242fccmd/compile/internal/escape: improve DWARF .debug_line numbering for literal rewriting optimizations + 2025-07-16385000b004runtime: fix idle time double-counting bug + 2025-07-16f506ad2644cmd/compile/internal/escape: speed up analyzing some functions with many closures + 2025-07-169c507e7942cmd/link, runtime: on Wasm, put only function index in method table and func table + 2025-07-169782dcfd16runtime: use 32-bit function index on Wasm + 2025-07-16c876bf9346cmd/internal/obj/wasm: use 64-bit instructions for indirect calls + 2025-07-15b4309ece66cmd/internal/doc: upgrade godoc pkgsite to 01b046e + 2025-07-1575a19dbcd7runtime: use memclrNoHeapPointers to clear inline mark bits + 2025-07-156d4a91c7a5runtime: only clear inline mark bits on span alloc if necessary + 2025-07-150c6296ab12runtime: have mergeInlineMarkBits also clear the inline mark bits + 2025-07-15397d2117ecruntime: merge inline mark bits with gcmarkBits 8 bytes at a time + 2025-07-157dceabd3beruntime/maps: fix typo in group.go comment (instrinsified -> intrinsified) + 2025-07-15d826bf4d74os: remove useless error check + 2025-07-14bb07e55affruntime: expand GOMAXPROCS documentation + 2025-07-149159cd4ec6encoding/json: decompose legacy options + 2025-07-14c6556b8eb3encoding/json/v2: add security section to doc + 2025-07-116ebb5f56d9runtime: gofmt after CL 643897 and CL 662455 + 2025-07-111e48ca7020encoding/json: remove legacy option to EscapeInvalidUTF8 + 2025-07-11a0a99cb22bencoding/json/v2: report wrapped io.ErrUnexpectedEOF + 2025-07-119d04122d24crypto/rsa: drop contradictory promise to keep PublicKey modulus secret + 2025-07-111ca23682ddcrypto/rsa: fix documentation formatting + 2025-07-114bc3373c8eruntime: turn off large memmove tests under asan/msan Change-Id: I1e32d964eba770b85421efb86b305a2242f24466
This commit is contained in:
commit
775fb52745
526 changed files with 12758 additions and 15109 deletions
8
doc/next/1-intro.md
Normal file
8
doc/next/1-intro.md
Normal file
|
|
@ -0,0 +1,8 @@
|
|||
<style>
|
||||
main ul li { margin: 0.5em 0; }
|
||||
</style>
|
||||
|
||||
## DRAFT RELEASE NOTES — Introduction to Go 1.26 {#introduction}
|
||||
|
||||
**Go 1.26 is not yet released. These are work-in-progress release notes.
|
||||
Go 1.26 is expected to be released in February 2026.**
|
||||
3
doc/next/2-language.md
Normal file
3
doc/next/2-language.md
Normal file
|
|
@ -0,0 +1,3 @@
|
|||
## Changes to the language {#language}
|
||||
|
||||
|
||||
11
doc/next/3-tools.md
Normal file
11
doc/next/3-tools.md
Normal file
|
|
@ -0,0 +1,11 @@
|
|||
## Tools {#tools}
|
||||
|
||||
### Go command {#go-command}
|
||||
|
||||
<!-- go.dev/issue/74667 -->
|
||||
`cmd/doc`, and `go tool doc` have been deleted. `go doc` can be used as
|
||||
a replacement for `go tool doc`: it takes the same flags and arguments and
|
||||
has the same behavior.
|
||||
|
||||
### Cgo {#cgo}
|
||||
|
||||
1
doc/next/4-runtime.md
Normal file
1
doc/next/4-runtime.md
Normal file
|
|
@ -0,0 +1 @@
|
|||
## Runtime {#runtime}
|
||||
7
doc/next/5-toolchain.md
Normal file
7
doc/next/5-toolchain.md
Normal file
|
|
@ -0,0 +1,7 @@
|
|||
## Compiler {#compiler}
|
||||
|
||||
## Assembler {#assembler}
|
||||
|
||||
## Linker {#linker}
|
||||
|
||||
|
||||
2
doc/next/6-stdlib/0-heading.md
Normal file
2
doc/next/6-stdlib/0-heading.md
Normal file
|
|
@ -0,0 +1,2 @@
|
|||
## Standard library {#library}
|
||||
|
||||
10
doc/next/6-stdlib/99-minor/0-heading.md
Normal file
10
doc/next/6-stdlib/99-minor/0-heading.md
Normal file
|
|
@ -0,0 +1,10 @@
|
|||
### Minor changes to the library {#minor_library_changes}
|
||||
|
||||
#### go/types
|
||||
|
||||
The `Var.Kind` method returns an enumeration of type `VarKind` that
|
||||
classifies the variable (package-level, local, receiver, parameter,
|
||||
result, or struct field). See issue #70250.
|
||||
|
||||
Callers of `NewVar` or `NewParam` are encouraged to call `Var.SetKind`
|
||||
to ensure that this attribute is set correctly in all cases.
|
||||
1
doc/next/6-stdlib/99-minor/README
Normal file
1
doc/next/6-stdlib/99-minor/README
Normal file
|
|
@ -0,0 +1 @@
|
|||
API changes and other small changes to the standard library go here.
|
||||
2
doc/next/7-ports.md
Normal file
2
doc/next/7-ports.md
Normal file
|
|
@ -0,0 +1,2 @@
|
|||
## Ports {#ports}
|
||||
|
||||
|
|
@ -693,14 +693,14 @@ func bmIndexRuneUnicode(rt *unicode.RangeTable, needle rune) func(b *testing.B,
|
|||
for _, r16 := range rt.R16 {
|
||||
for r := rune(r16.Lo); r <= rune(r16.Hi); r += rune(r16.Stride) {
|
||||
if r != needle {
|
||||
rs = append(rs, rune(r))
|
||||
rs = append(rs, r)
|
||||
}
|
||||
}
|
||||
}
|
||||
for _, r32 := range rt.R32 {
|
||||
for r := rune(r32.Lo); r <= rune(r32.Hi); r += rune(r32.Stride) {
|
||||
if r != needle {
|
||||
rs = append(rs, rune(r))
|
||||
rs = append(rs, r)
|
||||
}
|
||||
}
|
||||
}
|
||||
|
|
|
|||
12
src/cmd/api/testdata/src/pkg/p1/golden.txt
vendored
12
src/cmd/api/testdata/src/pkg/p1/golden.txt
vendored
|
|
@ -1,6 +1,6 @@
|
|||
pkg p1, const A //deprecated
|
||||
pkg p1, const A = 1
|
||||
pkg p1, const A ideal-int
|
||||
pkg p1, const A //deprecated
|
||||
pkg p1, const A64 = 1
|
||||
pkg p1, const A64 int64
|
||||
pkg p1, const AIsLowerA = 11
|
||||
|
|
@ -25,8 +25,8 @@ pkg p1, func TakesFunc(func(int) int)
|
|||
pkg p1, method (*B) JustOnB()
|
||||
pkg p1, method (*B) OnBothTandBPtr()
|
||||
pkg p1, method (*Embedded) OnEmbedded()
|
||||
pkg p1, method (*S2) SMethod(int8, int16, int64)
|
||||
pkg p1, method (*S2) SMethod //deprecated
|
||||
pkg p1, method (*S2) SMethod(int8, int16, int64)
|
||||
pkg p1, method (*T) JustOnT()
|
||||
pkg p1, method (*T) OnBothTandBPtr()
|
||||
pkg p1, method (B) OnBothTandBVal()
|
||||
|
|
@ -53,8 +53,8 @@ pkg p1, type Error interface { Error, Temporary }
|
|||
pkg p1, type Error interface, Error() string
|
||||
pkg p1, type Error interface, Temporary() bool
|
||||
pkg p1, type FuncType func(int, int, string) (*B, error)
|
||||
pkg p1, type I interface, Get(string) int64
|
||||
pkg p1, type I interface, Get //deprecated
|
||||
pkg p1, type I interface, Get(string) int64
|
||||
pkg p1, type I interface, GetNamed(string) int64
|
||||
pkg p1, type I interface, Name() string
|
||||
pkg p1, type I interface, PackageTwoMeth()
|
||||
|
|
@ -63,9 +63,9 @@ pkg p1, type I interface, unexported methods
|
|||
pkg p1, type MyInt int
|
||||
pkg p1, type Namer interface { Name }
|
||||
pkg p1, type Namer interface, Name() string
|
||||
pkg p1, type Private //deprecated
|
||||
pkg p1, type Private interface, X()
|
||||
pkg p1, type Private interface, unexported methods
|
||||
pkg p1, type Private //deprecated
|
||||
pkg p1, type Public interface { X, Y }
|
||||
pkg p1, type Public interface, X()
|
||||
pkg p1, type Public interface, Y()
|
||||
|
|
@ -84,8 +84,8 @@ pkg p1, type TPtrExported struct
|
|||
pkg p1, type TPtrExported struct, embedded *Embedded
|
||||
pkg p1, type TPtrUnexported struct
|
||||
pkg p1, type Time struct
|
||||
pkg p1, type URL struct
|
||||
pkg p1, type URL //deprecated
|
||||
pkg p1, type URL struct
|
||||
pkg p1, var Byte uint8
|
||||
pkg p1, var ByteConv []uint8
|
||||
pkg p1, var ByteFunc func(uint8) int32
|
||||
|
|
@ -97,8 +97,8 @@ pkg p1, var StrConv string
|
|||
pkg p1, var V string
|
||||
pkg p1, var V1 uint64
|
||||
pkg p1, var V2 p2.Twoer
|
||||
pkg p1, var VError Error
|
||||
pkg p1, var VError //deprecated
|
||||
pkg p1, var VError Error
|
||||
pkg p1, var X I
|
||||
pkg p1, var X0 int64
|
||||
pkg p1, var Y int
|
||||
|
|
|
|||
5
src/cmd/api/testdata/src/pkg/p2/golden.txt
vendored
5
src/cmd/api/testdata/src/pkg/p2/golden.txt
vendored
|
|
@ -1,8 +1,7 @@
|
|||
pkg p2, func F() string
|
||||
pkg p2, func F //deprecated
|
||||
pkg p2, func F() string
|
||||
pkg p2, func G() Twoer
|
||||
pkg p2, func NewError(string) error
|
||||
pkg p2, type Twoer interface { PackageTwoMeth }
|
||||
pkg p2, type Twoer interface, PackageTwoMeth()
|
||||
pkg p2, type Twoer interface, PackageTwoMeth //deprecated
|
||||
|
||||
pkg p2, type Twoer interface, PackageTwoMeth()
|
||||
|
|
|
|||
10
src/cmd/api/testdata/src/pkg/p4/golden.txt
vendored
10
src/cmd/api/testdata/src/pkg/p4/golden.txt
vendored
|
|
@ -1,6 +1,6 @@
|
|||
pkg p4, func NewPair[$0 interface{ M }, $1 interface{ ~int }]($0, $1) Pair[$0, $1]
|
||||
pkg p4, method (Pair[$0, $1]) Second() $1
|
||||
pkg p4, method (Pair[$0, $1]) First() $0
|
||||
pkg p4, type Pair[$0 interface{ M }, $1 interface{ ~int }] struct
|
||||
pkg p4, func Clone[$0 interface{ ~[]$1 }, $1 interface{}]($0) $0
|
||||
pkg p4, func Clone //deprecated
|
||||
pkg p4, func Clone[$0 interface{ ~[]$1 }, $1 interface{}]($0) $0
|
||||
pkg p4, func NewPair[$0 interface{ M }, $1 interface{ ~int }]($0, $1) Pair[$0, $1]
|
||||
pkg p4, method (Pair[$0, $1]) First() $0
|
||||
pkg p4, method (Pair[$0, $1]) Second() $1
|
||||
pkg p4, type Pair[$0 interface{ M }, $1 interface{ ~int }] struct
|
||||
|
|
|
|||
60
src/cmd/asm/internal/asm/testdata/loong64enc1.s
vendored
60
src/cmd/asm/internal/asm/testdata/loong64enc1.s
vendored
|
|
@ -510,6 +510,16 @@ lable2:
|
|||
VMOVQ V3.W[1], V7.W4 // 67e4f772
|
||||
VMOVQ V4.V[0], V6.V2 // 86f0f772
|
||||
|
||||
// Load data from memory and broadcast to each element of a vector register: VMOVQ offset(Rj), <Vd>.<T>
|
||||
VMOVQ (R4), V0.B16 // 80008030
|
||||
VMOVQ 1(R4), V1.H8 // 81044030
|
||||
VMOVQ 2(R4), V2.W4 // 82082030
|
||||
VMOVQ 3(R4), V3.V2 // 830c1030
|
||||
XVMOVQ (R4), X0.B32 // 80008032
|
||||
XVMOVQ 1(R4), X1.H16 // 81044032
|
||||
XVMOVQ 2(R4), X2.W8 // 82082032
|
||||
XVMOVQ 3(R4), X3.V4 // 830c1032
|
||||
|
||||
// VSEQ{B,H,W,V}, XVSEQ{B,H,W,V} instruction
|
||||
VSEQB V1, V2, V3 // 43040070
|
||||
VSEQH V1, V2, V3 // 43840070
|
||||
|
|
@ -1035,3 +1045,53 @@ lable2:
|
|||
PRELD (R4), $0 // 8000c02a
|
||||
PRELD -1(R4), $8 // 88fcff2a
|
||||
PRELD 8(R4), $31 // 9f20c02a
|
||||
|
||||
// [X]{VBITCLR/VBITSET/VBITREV}{B,H,W,V} instructions
|
||||
VBITCLRB V1, V2, V3 // 43040c71
|
||||
VBITCLRH V1, V2, V3 // 43840c71
|
||||
VBITCLRW V1, V2, V3 // 43040d71
|
||||
VBITCLRV V1, V2, V3 // 43840d71
|
||||
VBITSETB V1, V2, V3 // 43040e71
|
||||
VBITSETH V1, V2, V3 // 43840e71
|
||||
VBITSETW V1, V2, V3 // 43040f71
|
||||
VBITSETV V1, V2, V3 // 43840f71
|
||||
VBITREVB V1, V2, V3 // 43041071
|
||||
VBITREVH V1, V2, V3 // 43841071
|
||||
VBITREVW V1, V2, V3 // 43041171
|
||||
VBITREVV V1, V2, V3 // 43841171
|
||||
XVBITCLRB X3, X2, X1 // 410c0c75
|
||||
XVBITCLRH X3, X2, X1 // 418c0c75
|
||||
XVBITCLRW X3, X2, X1 // 410c0d75
|
||||
XVBITCLRV X3, X2, X1 // 418c0d75
|
||||
XVBITSETB X3, X2, X1 // 410c0e75
|
||||
XVBITSETH X3, X2, X1 // 418c0e75
|
||||
XVBITSETW X3, X2, X1 // 410c0f75
|
||||
XVBITSETV X3, X2, X1 // 418c0f75
|
||||
XVBITREVB X3, X2, X1 // 410c1075
|
||||
XVBITREVH X3, X2, X1 // 418c1075
|
||||
XVBITREVW X3, X2, X1 // 410c1175
|
||||
XVBITREVV X3, X2, X1 // 418c1175
|
||||
VBITCLRB $7, V2, V3 // 433c1073
|
||||
VBITCLRH $15, V2, V3 // 437c1073
|
||||
VBITCLRW $31, V2, V3 // 43fc1073
|
||||
VBITCLRV $63, V2, V3 // 43fc1173
|
||||
VBITSETB $7, V2, V3 // 433c1473
|
||||
VBITSETH $15, V2, V3 // 437c1473
|
||||
VBITSETW $31, V2, V3 // 43fc1473
|
||||
VBITSETV $63, V2, V3 // 43fc1573
|
||||
VBITREVB $7, V2, V3 // 433c1873
|
||||
VBITREVH $15, V2, V3 // 437c1873
|
||||
VBITREVW $31, V2, V3 // 43fc1873
|
||||
VBITREVV $63, V2, V3 // 43fc1973
|
||||
XVBITCLRB $7, X2, X1 // 413c1077
|
||||
XVBITCLRH $15, X2, X1 // 417c1077
|
||||
XVBITCLRW $31, X2, X1 // 41fc1077
|
||||
XVBITCLRV $63, X2, X1 // 41fc1177
|
||||
XVBITSETB $7, X2, X1 // 413c1477
|
||||
XVBITSETH $15, X2, X1 // 417c1477
|
||||
XVBITSETW $31, X2, X1 // 41fc1477
|
||||
XVBITSETV $63, X2, X1 // 41fc1577
|
||||
XVBITREVB $7, X2, X1 // 413c1877
|
||||
XVBITREVH $15, X2, X1 // 417c1877
|
||||
XVBITREVW $31, X2, X1 // 41fc1877
|
||||
XVBITREVV $63, X2, X1 // 41fc1977
|
||||
|
|
|
|||
19
src/cmd/asm/internal/asm/testdata/s390x.s
vendored
19
src/cmd/asm/internal/asm/testdata/s390x.s
vendored
|
|
@ -263,10 +263,15 @@ TEXT main·foo(SB),DUPOK|NOSPLIT,$16-0 // TEXT main.foo(SB), DUPOK|NOSPLIT, $16-
|
|||
NC $8, (R15), n-8(SP) // d407f010f000
|
||||
OC $8, (R15), n-8(SP) // d607f010f000
|
||||
MVC $8, (R15), n-8(SP) // d207f010f000
|
||||
MVC $256, 8192(R1), 8192(R2) // b90400a2c2a800002000b90400b1c2b800002000d2ffa000b000
|
||||
MVCIN $8, (R15), n-8(SP) // e807f010f000
|
||||
CLC $8, (R15), n-8(SP) // d507f000f010
|
||||
XC $256, -8(R15), -8(R15) // b90400afc2a8fffffff8d7ffa000a000
|
||||
MVC $256, 8192(R1), 8192(R2) // b90400a2c2a800002000b90400b1c2b800002000d2ffa000b000
|
||||
MVCLE 0, R4, R6 // a8640000
|
||||
MVCLE 4095, R4, R6 // a8640fff
|
||||
MVCLE $4095, R4, R6 // a8640fff
|
||||
MVCLE (R3), R4, R6 // a8643000
|
||||
MVCLE 10(R3), R4, R6 // a864300a
|
||||
|
||||
CMP R1, R2 // b9200012
|
||||
CMP R3, $32767 // a73f7fff
|
||||
|
|
@ -535,6 +540,18 @@ TEXT main·foo(SB),DUPOK|NOSPLIT,$16-0 // TEXT main.foo(SB), DUPOK|NOSPLIT, $16-
|
|||
VSTRCZBS V18, V20, V22, V24 // e78240306f8a
|
||||
VSTRCZHS V18, V20, V22, V24 // e78241306f8a
|
||||
VSTRCZFS V18, V20, V22, V24 // e78242306f8a
|
||||
VFMAXSB $1, V2, V3, V4 // e742301020ef
|
||||
WFMAXSB $2, V5, V6, V7 // e775602820ef
|
||||
WFMAXSB $2, F5, F6, F7 // e775602820ef
|
||||
VFMAXDB $3, V8, V9, V10 // e7a8903030ef
|
||||
WFMAXDB $4, V11, V12, V13 // e7dbc04830ef
|
||||
WFMAXDB $4, F11, F12, F13 // e7dbc04830ef
|
||||
VFMINSB $7, V14, V15, V16 // e70ef07028ee
|
||||
WFMINSB $8, V17, V18, V19 // e73120882eee
|
||||
WFMINSB $8, F1, F2, F3 // e731208820ee
|
||||
VFMINDB $9, V20, V21, V22 // e76450903eee
|
||||
WFMINDB $10, V23, V24, V25 // e79780a83eee
|
||||
WFMINDB $10, F7, F8, F9 // e79780a830ee
|
||||
|
||||
RET
|
||||
RET foo(SB)
|
||||
|
|
|
|||
|
|
@ -245,7 +245,7 @@ static void *thread(void *p) {
|
|||
return NULL;
|
||||
}
|
||||
void testSendSIG() {
|
||||
const int N = 20;
|
||||
enum { N = 20 };
|
||||
int i;
|
||||
pthread_t tid[N];
|
||||
for (i = 0; i < N; i++) {
|
||||
|
|
|
|||
|
|
@ -1812,7 +1812,7 @@ void _cgoPREFIX_Cfunc__Cmalloc(void *v) {
|
|||
void *ret;
|
||||
_cgo_tsan_acquire();
|
||||
ret = malloc(a->p0);
|
||||
if (ret == 0 && a->p0 == 0) {
|
||||
if (ret == NULL && a->p0 == 0) {
|
||||
ret = malloc(1);
|
||||
}
|
||||
a->r1 = ret;
|
||||
|
|
|
|||
|
|
@ -5,113 +5,23 @@
|
|||
package amd64
|
||||
|
||||
import (
|
||||
"cmd/compile/internal/ir"
|
||||
"cmd/compile/internal/objw"
|
||||
"cmd/compile/internal/types"
|
||||
"cmd/internal/obj"
|
||||
"cmd/internal/obj/x86"
|
||||
)
|
||||
|
||||
// DUFFZERO consists of repeated blocks of 4 MOVUPSs + LEAQ,
|
||||
// See runtime/mkduff.go.
|
||||
const (
|
||||
dzBlocks = 16 // number of MOV/ADD blocks
|
||||
dzBlockLen = 4 // number of clears per block
|
||||
dzBlockSize = 23 // size of instructions in a single block
|
||||
dzMovSize = 5 // size of single MOV instruction w/ offset
|
||||
dzLeaqSize = 4 // size of single LEAQ instruction
|
||||
dzClearStep = 16 // number of bytes cleared by each MOV instruction
|
||||
|
||||
dzClearLen = dzClearStep * dzBlockLen // bytes cleared by one block
|
||||
dzSize = dzBlocks * dzBlockSize
|
||||
)
|
||||
|
||||
// dzOff returns the offset for a jump into DUFFZERO.
|
||||
// b is the number of bytes to zero.
|
||||
func dzOff(b int64) int64 {
|
||||
off := int64(dzSize)
|
||||
off -= b / dzClearLen * dzBlockSize
|
||||
tailLen := b % dzClearLen
|
||||
if tailLen >= dzClearStep {
|
||||
off -= dzLeaqSize + dzMovSize*(tailLen/dzClearStep)
|
||||
}
|
||||
return off
|
||||
}
|
||||
|
||||
// duffzeroDI returns the pre-adjustment to DI for a call to DUFFZERO.
|
||||
// b is the number of bytes to zero.
|
||||
func dzDI(b int64) int64 {
|
||||
tailLen := b % dzClearLen
|
||||
if tailLen < dzClearStep {
|
||||
return 0
|
||||
}
|
||||
tailSteps := tailLen / dzClearStep
|
||||
return -dzClearStep * (dzBlockLen - tailSteps)
|
||||
}
|
||||
|
||||
func zerorange(pp *objw.Progs, p *obj.Prog, off, cnt int64, state *uint32) *obj.Prog {
|
||||
const (
|
||||
r13 = 1 << iota // if R13 is already zeroed.
|
||||
)
|
||||
|
||||
if cnt == 0 {
|
||||
return p
|
||||
if cnt%8 != 0 {
|
||||
panic("zeroed region not aligned")
|
||||
}
|
||||
|
||||
if cnt == 8 {
|
||||
for cnt >= 16 {
|
||||
p = pp.Append(p, x86.AMOVUPS, obj.TYPE_REG, x86.REG_X15, 0, obj.TYPE_MEM, x86.REG_SP, off)
|
||||
off += 16
|
||||
cnt -= 16
|
||||
}
|
||||
if cnt != 0 {
|
||||
p = pp.Append(p, x86.AMOVQ, obj.TYPE_REG, x86.REG_X15, 0, obj.TYPE_MEM, x86.REG_SP, off)
|
||||
} else if cnt <= int64(8*types.RegSize) {
|
||||
for i := int64(0); i < cnt/16; i++ {
|
||||
p = pp.Append(p, x86.AMOVUPS, obj.TYPE_REG, x86.REG_X15, 0, obj.TYPE_MEM, x86.REG_SP, off+i*16)
|
||||
}
|
||||
|
||||
if cnt%16 != 0 {
|
||||
p = pp.Append(p, x86.AMOVUPS, obj.TYPE_REG, x86.REG_X15, 0, obj.TYPE_MEM, x86.REG_SP, off+cnt-int64(16))
|
||||
}
|
||||
} else if cnt <= int64(128*types.RegSize) {
|
||||
// Save DI to r12. With the amd64 Go register abi, DI can contain
|
||||
// an incoming parameter, whereas R12 is always scratch.
|
||||
p = pp.Append(p, x86.AMOVQ, obj.TYPE_REG, x86.REG_DI, 0, obj.TYPE_REG, x86.REG_R12, 0)
|
||||
// Emit duffzero call
|
||||
p = pp.Append(p, leaptr, obj.TYPE_MEM, x86.REG_SP, off+dzDI(cnt), obj.TYPE_REG, x86.REG_DI, 0)
|
||||
p = pp.Append(p, obj.ADUFFZERO, obj.TYPE_NONE, 0, 0, obj.TYPE_ADDR, 0, dzOff(cnt))
|
||||
p.To.Sym = ir.Syms.Duffzero
|
||||
if cnt%16 != 0 {
|
||||
p = pp.Append(p, x86.AMOVUPS, obj.TYPE_REG, x86.REG_X15, 0, obj.TYPE_MEM, x86.REG_DI, -int64(8))
|
||||
}
|
||||
// Restore DI from r12
|
||||
p = pp.Append(p, x86.AMOVQ, obj.TYPE_REG, x86.REG_R12, 0, obj.TYPE_REG, x86.REG_DI, 0)
|
||||
|
||||
} else {
|
||||
// When the register ABI is in effect, at this point in the
|
||||
// prolog we may have live values in all of RAX,RDI,RCX. Save
|
||||
// them off to registers before the REPSTOSQ below, then
|
||||
// restore. Note that R12 and R13 are always available as
|
||||
// scratch regs; here we also use R15 (this is safe to do
|
||||
// since there won't be any globals accessed in the prolog).
|
||||
// See rewriteToUseGot() in obj6.go for more on r15 use.
|
||||
|
||||
// Save rax/rdi/rcx
|
||||
p = pp.Append(p, x86.AMOVQ, obj.TYPE_REG, x86.REG_DI, 0, obj.TYPE_REG, x86.REG_R12, 0)
|
||||
p = pp.Append(p, x86.AMOVQ, obj.TYPE_REG, x86.REG_AX, 0, obj.TYPE_REG, x86.REG_R13, 0)
|
||||
p = pp.Append(p, x86.AMOVQ, obj.TYPE_REG, x86.REG_CX, 0, obj.TYPE_REG, x86.REG_R15, 0)
|
||||
|
||||
// Set up the REPSTOSQ and kick it off.
|
||||
p = pp.Append(p, x86.AXORL, obj.TYPE_REG, x86.REG_AX, 0, obj.TYPE_REG, x86.REG_AX, 0)
|
||||
p = pp.Append(p, x86.AMOVQ, obj.TYPE_CONST, 0, cnt/int64(types.RegSize), obj.TYPE_REG, x86.REG_CX, 0)
|
||||
p = pp.Append(p, leaptr, obj.TYPE_MEM, x86.REG_SP, off, obj.TYPE_REG, x86.REG_DI, 0)
|
||||
p = pp.Append(p, x86.AREP, obj.TYPE_NONE, 0, 0, obj.TYPE_NONE, 0, 0)
|
||||
p = pp.Append(p, x86.ASTOSQ, obj.TYPE_NONE, 0, 0, obj.TYPE_NONE, 0, 0)
|
||||
|
||||
// Restore rax/rdi/rcx
|
||||
p = pp.Append(p, x86.AMOVQ, obj.TYPE_REG, x86.REG_R12, 0, obj.TYPE_REG, x86.REG_DI, 0)
|
||||
p = pp.Append(p, x86.AMOVQ, obj.TYPE_REG, x86.REG_R13, 0, obj.TYPE_REG, x86.REG_AX, 0)
|
||||
p = pp.Append(p, x86.AMOVQ, obj.TYPE_REG, x86.REG_R15, 0, obj.TYPE_REG, x86.REG_CX, 0)
|
||||
|
||||
// Record the fact that r13 is no longer zero.
|
||||
*state &= ^uint32(r13)
|
||||
}
|
||||
|
||||
return p
|
||||
}
|
||||
|
||||
|
|
|
|||
|
|
@ -17,6 +17,7 @@ import (
|
|||
"cmd/compile/internal/types"
|
||||
"cmd/internal/obj"
|
||||
"cmd/internal/obj/x86"
|
||||
"internal/abi"
|
||||
)
|
||||
|
||||
// ssaMarkMoves marks any MOVXconst ops that need to avoid clobbering flags.
|
||||
|
|
@ -147,6 +148,15 @@ func memIdx(a *obj.Addr, v *ssa.Value) {
|
|||
|
||||
// DUFFZERO consists of repeated blocks of 4 MOVUPSs + LEAQ,
|
||||
// See runtime/mkduff.go.
|
||||
const (
|
||||
dzBlocks = 16 // number of MOV/ADD blocks
|
||||
dzBlockLen = 4 // number of clears per block
|
||||
dzBlockSize = 23 // size of instructions in a single block
|
||||
dzMovSize = 5 // size of single MOV instruction w/ offset
|
||||
dzLeaqSize = 4 // size of single LEAQ instruction
|
||||
dzClearStep = 16 // number of bytes cleared by each MOV instruction
|
||||
)
|
||||
|
||||
func duffStart(size int64) int64 {
|
||||
x, _ := duff(size)
|
||||
return x
|
||||
|
|
@ -1001,26 +1011,103 @@ func ssaGenValue(s *ssagen.State, v *ssa.Value) {
|
|||
ssagen.AddAux(&p.From, v)
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = v.Reg()
|
||||
case ssa.OpAMD64DUFFZERO:
|
||||
|
||||
case ssa.OpAMD64LoweredZero:
|
||||
if s.ABI != obj.ABIInternal {
|
||||
// zero X15 manually
|
||||
opregreg(s, x86.AXORPS, x86.REG_X15, x86.REG_X15)
|
||||
}
|
||||
off := duffStart(v.AuxInt)
|
||||
adj := duffAdj(v.AuxInt)
|
||||
var p *obj.Prog
|
||||
if adj != 0 {
|
||||
p = s.Prog(x86.ALEAQ)
|
||||
p.From.Type = obj.TYPE_MEM
|
||||
p.From.Offset = adj
|
||||
p.From.Reg = x86.REG_DI
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = x86.REG_DI
|
||||
ptrReg := v.Args[0].Reg()
|
||||
n := v.AuxInt
|
||||
if n < 16 {
|
||||
v.Fatalf("Zero too small %d", n)
|
||||
}
|
||||
p = s.Prog(obj.ADUFFZERO)
|
||||
p.To.Type = obj.TYPE_ADDR
|
||||
p.To.Sym = ir.Syms.Duffzero
|
||||
p.To.Offset = off
|
||||
zero16 := func(off int64) {
|
||||
zero16(s, ptrReg, off)
|
||||
}
|
||||
|
||||
// Generate zeroing instructions.
|
||||
var off int64
|
||||
for n >= 16 {
|
||||
zero16(off)
|
||||
off += 16
|
||||
n -= 16
|
||||
}
|
||||
if n != 0 {
|
||||
// use partially overlapped write.
|
||||
// TODO: n <= 8, use smaller write?
|
||||
zero16(off + n - 16)
|
||||
}
|
||||
|
||||
case ssa.OpAMD64LoweredZeroLoop:
|
||||
if s.ABI != obj.ABIInternal {
|
||||
// zero X15 manually
|
||||
opregreg(s, x86.AXORPS, x86.REG_X15, x86.REG_X15)
|
||||
}
|
||||
ptrReg := v.Args[0].Reg()
|
||||
countReg := v.RegTmp()
|
||||
n := v.AuxInt
|
||||
loopSize := int64(64)
|
||||
if n < 3*loopSize {
|
||||
// - a loop count of 0 won't work.
|
||||
// - a loop count of 1 is useless.
|
||||
// - a loop count of 2 is a code size ~tie
|
||||
// 4 instructions to implement the loop
|
||||
// 4 instructions in the loop body
|
||||
// vs
|
||||
// 8 instructions in the straightline code
|
||||
// Might as well use straightline code.
|
||||
v.Fatalf("ZeroLoop size too small %d", n)
|
||||
}
|
||||
zero16 := func(off int64) {
|
||||
zero16(s, ptrReg, off)
|
||||
}
|
||||
|
||||
// Put iteration count in a register.
|
||||
// MOVL $n, countReg
|
||||
p := s.Prog(x86.AMOVL)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = n / loopSize
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = countReg
|
||||
cntInit := p
|
||||
|
||||
// Zero loopSize bytes starting at ptrReg.
|
||||
for i := range loopSize / 16 {
|
||||
zero16(i * 16)
|
||||
}
|
||||
// ADDQ $loopSize, ptrReg
|
||||
p = s.Prog(x86.AADDQ)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = loopSize
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = ptrReg
|
||||
// DECL countReg
|
||||
p = s.Prog(x86.ADECL)
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = countReg
|
||||
// Jump to first instruction in loop if we're not done yet.
|
||||
// JNE head
|
||||
p = s.Prog(x86.AJNE)
|
||||
p.To.Type = obj.TYPE_BRANCH
|
||||
p.To.SetTarget(cntInit.Link)
|
||||
|
||||
// Multiples of the loop size are now done.
|
||||
n %= loopSize
|
||||
|
||||
// Write any fractional portion.
|
||||
var off int64
|
||||
for n >= 16 {
|
||||
zero16(off)
|
||||
off += 16
|
||||
n -= 16
|
||||
}
|
||||
if n != 0 {
|
||||
// Use partially-overlapping write.
|
||||
// TODO: n <= 8, use smaller write?
|
||||
zero16(off + n - 16)
|
||||
}
|
||||
|
||||
case ssa.OpAMD64DUFFCOPY:
|
||||
p := s.Prog(obj.ADUFFCOPY)
|
||||
p.To.Type = obj.TYPE_ADDR
|
||||
|
|
@ -1151,12 +1238,91 @@ func ssaGenValue(s *ssagen.State, v *ssa.Value) {
|
|||
// AuxInt encodes how many buffer entries we need.
|
||||
p.To.Sym = ir.Syms.GCWriteBarrier[v.AuxInt-1]
|
||||
|
||||
case ssa.OpAMD64LoweredPanicBoundsA, ssa.OpAMD64LoweredPanicBoundsB, ssa.OpAMD64LoweredPanicBoundsC:
|
||||
p := s.Prog(obj.ACALL)
|
||||
case ssa.OpAMD64LoweredPanicBoundsRR, ssa.OpAMD64LoweredPanicBoundsRC, ssa.OpAMD64LoweredPanicBoundsCR, ssa.OpAMD64LoweredPanicBoundsCC:
|
||||
// Compute the constant we put in the PCData entry for this call.
|
||||
code, signed := ssa.BoundsKind(v.AuxInt).Code()
|
||||
xIsReg := false
|
||||
yIsReg := false
|
||||
xVal := 0
|
||||
yVal := 0
|
||||
switch v.Op {
|
||||
case ssa.OpAMD64LoweredPanicBoundsRR:
|
||||
xIsReg = true
|
||||
xVal = int(v.Args[0].Reg() - x86.REG_AX)
|
||||
yIsReg = true
|
||||
yVal = int(v.Args[1].Reg() - x86.REG_AX)
|
||||
case ssa.OpAMD64LoweredPanicBoundsRC:
|
||||
xIsReg = true
|
||||
xVal = int(v.Args[0].Reg() - x86.REG_AX)
|
||||
c := v.Aux.(ssa.PanicBoundsC).C
|
||||
if c >= 0 && c <= abi.BoundsMaxConst {
|
||||
yVal = int(c)
|
||||
} else {
|
||||
// Move constant to a register
|
||||
yIsReg = true
|
||||
if yVal == xVal {
|
||||
yVal = 1
|
||||
}
|
||||
p := s.Prog(x86.AMOVQ)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = x86.REG_AX + int16(yVal)
|
||||
}
|
||||
case ssa.OpAMD64LoweredPanicBoundsCR:
|
||||
yIsReg = true
|
||||
yVal := int(v.Args[0].Reg() - x86.REG_AX)
|
||||
c := v.Aux.(ssa.PanicBoundsC).C
|
||||
if c >= 0 && c <= abi.BoundsMaxConst {
|
||||
xVal = int(c)
|
||||
} else {
|
||||
// Move constant to a register
|
||||
xIsReg = true
|
||||
if xVal == yVal {
|
||||
xVal = 1
|
||||
}
|
||||
p := s.Prog(x86.AMOVQ)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = x86.REG_AX + int16(xVal)
|
||||
}
|
||||
case ssa.OpAMD64LoweredPanicBoundsCC:
|
||||
c := v.Aux.(ssa.PanicBoundsCC).Cx
|
||||
if c >= 0 && c <= abi.BoundsMaxConst {
|
||||
xVal = int(c)
|
||||
} else {
|
||||
// Move constant to a register
|
||||
xIsReg = true
|
||||
p := s.Prog(x86.AMOVQ)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = x86.REG_AX + int16(xVal)
|
||||
}
|
||||
c = v.Aux.(ssa.PanicBoundsCC).Cy
|
||||
if c >= 0 && c <= abi.BoundsMaxConst {
|
||||
yVal = int(c)
|
||||
} else {
|
||||
// Move constant to a register
|
||||
yIsReg = true
|
||||
yVal = 1
|
||||
p := s.Prog(x86.AMOVQ)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = x86.REG_AX + int16(yVal)
|
||||
}
|
||||
}
|
||||
c := abi.BoundsEncode(code, signed, xIsReg, yIsReg, xVal, yVal)
|
||||
|
||||
p := s.Prog(obj.APCDATA)
|
||||
p.From.SetConst(abi.PCDATA_PanicBounds)
|
||||
p.To.SetConst(int64(c))
|
||||
p = s.Prog(obj.ACALL)
|
||||
p.To.Type = obj.TYPE_MEM
|
||||
p.To.Name = obj.NAME_EXTERN
|
||||
p.To.Sym = ssagen.BoundsCheckFunc[v.AuxInt]
|
||||
s.UseArgs(int64(2 * types.PtrSize)) // space used in callee args area by assembly stubs
|
||||
p.To.Sym = ir.Syms.PanicBounds
|
||||
|
||||
case ssa.OpAMD64NEGQ, ssa.OpAMD64NEGL,
|
||||
ssa.OpAMD64BSWAPQ, ssa.OpAMD64BSWAPL,
|
||||
|
|
@ -1931,6 +2097,17 @@ func spillArgReg(pp *objw.Progs, p *obj.Prog, f *ssa.Func, t *types.Type, reg in
|
|||
return p
|
||||
}
|
||||
|
||||
// zero 16 bytes at reg+off.
|
||||
func zero16(s *ssagen.State, reg int16, off int64) {
|
||||
// MOVUPS X15, off(ptrReg)
|
||||
p := s.Prog(x86.AMOVUPS)
|
||||
p.From.Type = obj.TYPE_REG
|
||||
p.From.Reg = x86.REG_X15
|
||||
p.To.Type = obj.TYPE_MEM
|
||||
p.To.Reg = reg
|
||||
p.To.Offset = off
|
||||
}
|
||||
|
||||
// XXX maybe make this part of v.Reg?
|
||||
// On the other hand, it is architecture-specific.
|
||||
func simdReg(v *ssa.Value) int16 {
|
||||
|
|
|
|||
|
|
@ -18,6 +18,7 @@ import (
|
|||
"cmd/compile/internal/types"
|
||||
"cmd/internal/obj"
|
||||
"cmd/internal/obj/arm"
|
||||
"internal/abi"
|
||||
)
|
||||
|
||||
// loadByType returns the load instruction of the given type.
|
||||
|
|
@ -712,18 +713,167 @@ func ssaGenValue(s *ssagen.State, v *ssa.Value) {
|
|||
p.To.Name = obj.NAME_EXTERN
|
||||
// AuxInt encodes how many buffer entries we need.
|
||||
p.To.Sym = ir.Syms.GCWriteBarrier[v.AuxInt-1]
|
||||
case ssa.OpARMLoweredPanicBoundsA, ssa.OpARMLoweredPanicBoundsB, ssa.OpARMLoweredPanicBoundsC:
|
||||
p := s.Prog(obj.ACALL)
|
||||
|
||||
case ssa.OpARMLoweredPanicBoundsRR, ssa.OpARMLoweredPanicBoundsRC, ssa.OpARMLoweredPanicBoundsCR, ssa.OpARMLoweredPanicBoundsCC,
|
||||
ssa.OpARMLoweredPanicExtendRR, ssa.OpARMLoweredPanicExtendRC:
|
||||
// Compute the constant we put in the PCData entry for this call.
|
||||
code, signed := ssa.BoundsKind(v.AuxInt).Code()
|
||||
xIsReg := false
|
||||
yIsReg := false
|
||||
xVal := 0
|
||||
yVal := 0
|
||||
extend := false
|
||||
switch v.Op {
|
||||
case ssa.OpARMLoweredPanicBoundsRR:
|
||||
xIsReg = true
|
||||
xVal = int(v.Args[0].Reg() - arm.REG_R0)
|
||||
yIsReg = true
|
||||
yVal = int(v.Args[1].Reg() - arm.REG_R0)
|
||||
case ssa.OpARMLoweredPanicExtendRR:
|
||||
extend = true
|
||||
xIsReg = true
|
||||
hi := int(v.Args[0].Reg() - arm.REG_R0)
|
||||
lo := int(v.Args[1].Reg() - arm.REG_R0)
|
||||
xVal = hi<<2 + lo // encode 2 register numbers
|
||||
yIsReg = true
|
||||
yVal = int(v.Args[2].Reg() - arm.REG_R0)
|
||||
case ssa.OpARMLoweredPanicBoundsRC:
|
||||
xIsReg = true
|
||||
xVal = int(v.Args[0].Reg() - arm.REG_R0)
|
||||
c := v.Aux.(ssa.PanicBoundsC).C
|
||||
if c >= 0 && c <= abi.BoundsMaxConst {
|
||||
yVal = int(c)
|
||||
} else {
|
||||
// Move constant to a register
|
||||
yIsReg = true
|
||||
if yVal == xVal {
|
||||
yVal = 1
|
||||
}
|
||||
p := s.Prog(arm.AMOVW)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = arm.REG_R0 + int16(yVal)
|
||||
}
|
||||
case ssa.OpARMLoweredPanicExtendRC:
|
||||
extend = true
|
||||
xIsReg = true
|
||||
hi := int(v.Args[0].Reg() - arm.REG_R0)
|
||||
lo := int(v.Args[1].Reg() - arm.REG_R0)
|
||||
xVal = hi<<2 + lo // encode 2 register numbers
|
||||
c := v.Aux.(ssa.PanicBoundsC).C
|
||||
if c >= 0 && c <= abi.BoundsMaxConst {
|
||||
yVal = int(c)
|
||||
} else {
|
||||
// Move constant to a register
|
||||
for yVal == hi || yVal == lo {
|
||||
yVal++
|
||||
}
|
||||
p := s.Prog(arm.AMOVW)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = arm.REG_R0 + int16(yVal)
|
||||
}
|
||||
case ssa.OpARMLoweredPanicBoundsCR:
|
||||
yIsReg = true
|
||||
yVal := int(v.Args[0].Reg() - arm.REG_R0)
|
||||
c := v.Aux.(ssa.PanicBoundsC).C
|
||||
if c >= 0 && c <= abi.BoundsMaxConst {
|
||||
xVal = int(c)
|
||||
} else if signed && int64(int32(c)) == c || !signed && int64(uint32(c)) == c {
|
||||
// Move constant to a register
|
||||
xIsReg = true
|
||||
if xVal == yVal {
|
||||
xVal = 1
|
||||
}
|
||||
p := s.Prog(arm.AMOVW)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = arm.REG_R0 + int16(xVal)
|
||||
} else {
|
||||
// Move constant to two registers
|
||||
extend = true
|
||||
xIsReg = true
|
||||
hi := 0
|
||||
lo := 1
|
||||
if hi == yVal {
|
||||
hi = 2
|
||||
}
|
||||
if lo == yVal {
|
||||
lo = 2
|
||||
}
|
||||
xVal = hi<<2 + lo
|
||||
p := s.Prog(arm.AMOVW)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c >> 32
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = arm.REG_R0 + int16(hi)
|
||||
p = s.Prog(arm.AMOVW)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = int64(int32(c))
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = arm.REG_R0 + int16(lo)
|
||||
}
|
||||
case ssa.OpARMLoweredPanicBoundsCC:
|
||||
c := v.Aux.(ssa.PanicBoundsCC).Cx
|
||||
if c >= 0 && c <= abi.BoundsMaxConst {
|
||||
xVal = int(c)
|
||||
} else if signed && int64(int32(c)) == c || !signed && int64(uint32(c)) == c {
|
||||
// Move constant to a register
|
||||
xIsReg = true
|
||||
p := s.Prog(arm.AMOVW)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = arm.REG_R0 + int16(xVal)
|
||||
} else {
|
||||
// Move constant to two registers
|
||||
extend = true
|
||||
xIsReg = true
|
||||
hi := 0
|
||||
lo := 1
|
||||
xVal = hi<<2 + lo
|
||||
p := s.Prog(arm.AMOVW)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c >> 32
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = arm.REG_R0 + int16(hi)
|
||||
p = s.Prog(arm.AMOVW)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = int64(int32(c))
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = arm.REG_R0 + int16(lo)
|
||||
}
|
||||
c = v.Aux.(ssa.PanicBoundsCC).Cy
|
||||
if c >= 0 && c <= abi.BoundsMaxConst {
|
||||
yVal = int(c)
|
||||
} else {
|
||||
// Move constant to a register
|
||||
yIsReg = true
|
||||
yVal = 2
|
||||
p := s.Prog(arm.AMOVW)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = arm.REG_R0 + int16(yVal)
|
||||
}
|
||||
}
|
||||
c := abi.BoundsEncode(code, signed, xIsReg, yIsReg, xVal, yVal)
|
||||
|
||||
p := s.Prog(obj.APCDATA)
|
||||
p.From.SetConst(abi.PCDATA_PanicBounds)
|
||||
p.To.SetConst(int64(c))
|
||||
p = s.Prog(obj.ACALL)
|
||||
p.To.Type = obj.TYPE_MEM
|
||||
p.To.Name = obj.NAME_EXTERN
|
||||
p.To.Sym = ssagen.BoundsCheckFunc[v.AuxInt]
|
||||
s.UseArgs(8) // space used in callee args area by assembly stubs
|
||||
case ssa.OpARMLoweredPanicExtendA, ssa.OpARMLoweredPanicExtendB, ssa.OpARMLoweredPanicExtendC:
|
||||
p := s.Prog(obj.ACALL)
|
||||
p.To.Type = obj.TYPE_MEM
|
||||
p.To.Name = obj.NAME_EXTERN
|
||||
p.To.Sym = ssagen.ExtendCheckFunc[v.AuxInt]
|
||||
s.UseArgs(12) // space used in callee args area by assembly stubs
|
||||
if extend {
|
||||
p.To.Sym = ir.Syms.PanicExtend
|
||||
} else {
|
||||
p.To.Sym = ir.Syms.PanicBounds
|
||||
}
|
||||
|
||||
case ssa.OpARMDUFFZERO:
|
||||
p := s.Prog(obj.ADUFFZERO)
|
||||
p.To.Type = obj.TYPE_MEM
|
||||
|
|
|
|||
|
|
@ -5,9 +5,7 @@
|
|||
package arm64
|
||||
|
||||
import (
|
||||
"cmd/compile/internal/ir"
|
||||
"cmd/compile/internal/objw"
|
||||
"cmd/compile/internal/types"
|
||||
"cmd/internal/obj"
|
||||
"cmd/internal/obj/arm64"
|
||||
)
|
||||
|
|
@ -22,47 +20,20 @@ func padframe(frame int64) int64 {
|
|||
}
|
||||
|
||||
func zerorange(pp *objw.Progs, p *obj.Prog, off, cnt int64, _ *uint32) *obj.Prog {
|
||||
if cnt == 0 {
|
||||
return p
|
||||
if cnt%8 != 0 {
|
||||
panic("zeroed region not aligned")
|
||||
}
|
||||
if cnt < int64(4*types.PtrSize) {
|
||||
for i := int64(0); i < cnt; i += int64(types.PtrSize) {
|
||||
p = pp.Append(p, arm64.AMOVD, obj.TYPE_REG, arm64.REGZERO, 0, obj.TYPE_MEM, arm64.REGSP, 8+off+i)
|
||||
}
|
||||
} else if cnt <= int64(128*types.PtrSize) {
|
||||
if cnt%(2*int64(types.PtrSize)) != 0 {
|
||||
p = pp.Append(p, arm64.AMOVD, obj.TYPE_REG, arm64.REGZERO, 0, obj.TYPE_MEM, arm64.REGSP, 8+off)
|
||||
off += int64(types.PtrSize)
|
||||
cnt -= int64(types.PtrSize)
|
||||
}
|
||||
p = pp.Append(p, arm64.AMOVD, obj.TYPE_REG, arm64.REGSP, 0, obj.TYPE_REG, arm64.REG_R20, 0)
|
||||
p = pp.Append(p, arm64.AADD, obj.TYPE_CONST, 0, 8+off, obj.TYPE_REG, arm64.REG_R20, 0)
|
||||
p.Reg = arm64.REG_R20
|
||||
p = pp.Append(p, obj.ADUFFZERO, obj.TYPE_NONE, 0, 0, obj.TYPE_MEM, 0, 0)
|
||||
p.To.Name = obj.NAME_EXTERN
|
||||
p.To.Sym = ir.Syms.Duffzero
|
||||
p.To.Offset = 4 * (64 - cnt/(2*int64(types.PtrSize)))
|
||||
} else {
|
||||
// Not using REGTMP, so this is async preemptible (async preemption clobbers REGTMP).
|
||||
// We are at the function entry, where no register is live, so it is okay to clobber
|
||||
// other registers
|
||||
const rtmp = arm64.REG_R20
|
||||
p = pp.Append(p, arm64.AMOVD, obj.TYPE_CONST, 0, 8+off-8, obj.TYPE_REG, rtmp, 0)
|
||||
p = pp.Append(p, arm64.AMOVD, obj.TYPE_REG, arm64.REGSP, 0, obj.TYPE_REG, arm64.REGRT1, 0)
|
||||
p = pp.Append(p, arm64.AADD, obj.TYPE_REG, rtmp, 0, obj.TYPE_REG, arm64.REGRT1, 0)
|
||||
p.Reg = arm64.REGRT1
|
||||
p = pp.Append(p, arm64.AMOVD, obj.TYPE_CONST, 0, cnt, obj.TYPE_REG, rtmp, 0)
|
||||
p = pp.Append(p, arm64.AADD, obj.TYPE_REG, rtmp, 0, obj.TYPE_REG, arm64.REGRT2, 0)
|
||||
p.Reg = arm64.REGRT1
|
||||
p = pp.Append(p, arm64.AMOVD, obj.TYPE_REG, arm64.REGZERO, 0, obj.TYPE_MEM, arm64.REGRT1, int64(types.PtrSize))
|
||||
p.Scond = arm64.C_XPRE
|
||||
p1 := p
|
||||
p = pp.Append(p, arm64.ACMP, obj.TYPE_REG, arm64.REGRT1, 0, obj.TYPE_NONE, 0, 0)
|
||||
p.Reg = arm64.REGRT2
|
||||
p = pp.Append(p, arm64.ABNE, obj.TYPE_NONE, 0, 0, obj.TYPE_BRANCH, 0, 0)
|
||||
p.To.SetTarget(p1)
|
||||
off += 8 // return address was ignored in offset calculation
|
||||
for cnt >= 16 && off < 512 {
|
||||
p = pp.Append(p, arm64.ASTP, obj.TYPE_REGREG, arm64.REGZERO, arm64.REGZERO, obj.TYPE_MEM, arm64.REGSP, off)
|
||||
off += 16
|
||||
cnt -= 16
|
||||
}
|
||||
for cnt != 0 {
|
||||
p = pp.Append(p, arm64.AMOVD, obj.TYPE_REG, arm64.REGZERO, 0, obj.TYPE_MEM, arm64.REGSP, off)
|
||||
off += 8
|
||||
cnt -= 8
|
||||
}
|
||||
|
||||
return p
|
||||
}
|
||||
|
||||
|
|
|
|||
|
|
@ -16,6 +16,7 @@ import (
|
|||
"cmd/compile/internal/types"
|
||||
"cmd/internal/obj"
|
||||
"cmd/internal/obj/arm64"
|
||||
"internal/abi"
|
||||
)
|
||||
|
||||
// loadByType returns the load instruction of the given type.
|
||||
|
|
@ -1122,12 +1123,91 @@ func ssaGenValue(s *ssagen.State, v *ssa.Value) {
|
|||
// AuxInt encodes how many buffer entries we need.
|
||||
p.To.Sym = ir.Syms.GCWriteBarrier[v.AuxInt-1]
|
||||
|
||||
case ssa.OpARM64LoweredPanicBoundsA, ssa.OpARM64LoweredPanicBoundsB, ssa.OpARM64LoweredPanicBoundsC:
|
||||
p := s.Prog(obj.ACALL)
|
||||
case ssa.OpARM64LoweredPanicBoundsRR, ssa.OpARM64LoweredPanicBoundsRC, ssa.OpARM64LoweredPanicBoundsCR, ssa.OpARM64LoweredPanicBoundsCC:
|
||||
// Compute the constant we put in the PCData entry for this call.
|
||||
code, signed := ssa.BoundsKind(v.AuxInt).Code()
|
||||
xIsReg := false
|
||||
yIsReg := false
|
||||
xVal := 0
|
||||
yVal := 0
|
||||
switch v.Op {
|
||||
case ssa.OpARM64LoweredPanicBoundsRR:
|
||||
xIsReg = true
|
||||
xVal = int(v.Args[0].Reg() - arm64.REG_R0)
|
||||
yIsReg = true
|
||||
yVal = int(v.Args[1].Reg() - arm64.REG_R0)
|
||||
case ssa.OpARM64LoweredPanicBoundsRC:
|
||||
xIsReg = true
|
||||
xVal = int(v.Args[0].Reg() - arm64.REG_R0)
|
||||
c := v.Aux.(ssa.PanicBoundsC).C
|
||||
if c >= 0 && c <= abi.BoundsMaxConst {
|
||||
yVal = int(c)
|
||||
} else {
|
||||
// Move constant to a register
|
||||
yIsReg = true
|
||||
if yVal == xVal {
|
||||
yVal = 1
|
||||
}
|
||||
p := s.Prog(arm64.AMOVD)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = arm64.REG_R0 + int16(yVal)
|
||||
}
|
||||
case ssa.OpARM64LoweredPanicBoundsCR:
|
||||
yIsReg = true
|
||||
yVal := int(v.Args[0].Reg() - arm64.REG_R0)
|
||||
c := v.Aux.(ssa.PanicBoundsC).C
|
||||
if c >= 0 && c <= abi.BoundsMaxConst {
|
||||
xVal = int(c)
|
||||
} else {
|
||||
// Move constant to a register
|
||||
if xVal == yVal {
|
||||
xVal = 1
|
||||
}
|
||||
p := s.Prog(arm64.AMOVD)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = arm64.REG_R0 + int16(xVal)
|
||||
}
|
||||
case ssa.OpARM64LoweredPanicBoundsCC:
|
||||
c := v.Aux.(ssa.PanicBoundsCC).Cx
|
||||
if c >= 0 && c <= abi.BoundsMaxConst {
|
||||
xVal = int(c)
|
||||
} else {
|
||||
// Move constant to a register
|
||||
xIsReg = true
|
||||
p := s.Prog(arm64.AMOVD)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = arm64.REG_R0 + int16(xVal)
|
||||
}
|
||||
c = v.Aux.(ssa.PanicBoundsCC).Cy
|
||||
if c >= 0 && c <= abi.BoundsMaxConst {
|
||||
yVal = int(c)
|
||||
} else {
|
||||
// Move constant to a register
|
||||
yIsReg = true
|
||||
yVal = 1
|
||||
p := s.Prog(arm64.AMOVD)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = arm64.REG_R0 + int16(yVal)
|
||||
}
|
||||
}
|
||||
c := abi.BoundsEncode(code, signed, xIsReg, yIsReg, xVal, yVal)
|
||||
|
||||
p := s.Prog(obj.APCDATA)
|
||||
p.From.SetConst(abi.PCDATA_PanicBounds)
|
||||
p.To.SetConst(int64(c))
|
||||
p = s.Prog(obj.ACALL)
|
||||
p.To.Type = obj.TYPE_MEM
|
||||
p.To.Name = obj.NAME_EXTERN
|
||||
p.To.Sym = ssagen.BoundsCheckFunc[v.AuxInt]
|
||||
s.UseArgs(16) // space used in callee args area by assembly stubs
|
||||
p.To.Sym = ir.Syms.PanicBounds
|
||||
|
||||
case ssa.OpARM64LoweredNilCheck:
|
||||
// Issue a load which will fault if arg is nil.
|
||||
p := s.Prog(arm64.AMOVB)
|
||||
|
|
|
|||
|
|
@ -203,7 +203,7 @@ func createDwarfVars(fnsym *obj.LSym, complexOK bool, fn *ir.Func, apDecls []*ir
|
|||
continue
|
||||
}
|
||||
if n.Class != ir.PPARAMOUT || !n.IsOutputParamInRegisters() {
|
||||
panic("invalid ir.Name on debugInfo.RegOutputParams list")
|
||||
base.Fatalf("invalid ir.Name on debugInfo.RegOutputParams list")
|
||||
}
|
||||
dcl = append(dcl, n)
|
||||
}
|
||||
|
|
@ -248,11 +248,6 @@ func createDwarfVars(fnsym *obj.LSym, complexOK bool, fn *ir.Func, apDecls []*ir
|
|||
if n.Class == ir.PPARAM || n.Class == ir.PPARAMOUT {
|
||||
tag = dwarf.DW_TAG_formal_parameter
|
||||
}
|
||||
if n.Esc() == ir.EscHeap {
|
||||
// The variable in question has been promoted to the heap.
|
||||
// Its address is in n.Heapaddr.
|
||||
// TODO(thanm): generate a better location expression
|
||||
}
|
||||
inlIndex := 0
|
||||
if base.Flag.GenDwarfInl > 1 {
|
||||
if n.InlFormal() || n.InlLocal() {
|
||||
|
|
@ -263,7 +258,7 @@ func createDwarfVars(fnsym *obj.LSym, complexOK bool, fn *ir.Func, apDecls []*ir
|
|||
}
|
||||
}
|
||||
declpos := base.Ctxt.InnermostPos(n.Pos())
|
||||
vars = append(vars, &dwarf.Var{
|
||||
dvar := &dwarf.Var{
|
||||
Name: n.Sym().Name,
|
||||
IsReturnValue: isReturnValue,
|
||||
Tag: tag,
|
||||
|
|
@ -277,8 +272,19 @@ func createDwarfVars(fnsym *obj.LSym, complexOK bool, fn *ir.Func, apDecls []*ir
|
|||
ChildIndex: -1,
|
||||
DictIndex: n.DictIndex,
|
||||
ClosureOffset: closureOffset(n, closureVars),
|
||||
})
|
||||
// Record go type of to insure that it gets emitted by the linker.
|
||||
}
|
||||
if n.Esc() == ir.EscHeap {
|
||||
if n.Heapaddr == nil {
|
||||
base.Fatalf("invalid heap allocated var without Heapaddr")
|
||||
}
|
||||
debug := fn.DebugInfo.(*ssa.FuncDebug)
|
||||
list := createHeapDerefLocationList(n, debug.EntryID)
|
||||
dvar.PutLocationList = func(listSym, startPC dwarf.Sym) {
|
||||
debug.PutLocationList(list, base.Ctxt, listSym.(*obj.LSym), startPC.(*obj.LSym))
|
||||
}
|
||||
}
|
||||
vars = append(vars, dvar)
|
||||
// Record go type to ensure that it gets emitted by the linker.
|
||||
fnsym.Func().RecordAutoType(reflectdata.TypeLinksym(n.Type()))
|
||||
}
|
||||
|
||||
|
|
@ -550,11 +556,34 @@ func createComplexVar(fnsym *obj.LSym, fn *ir.Func, varID ssa.VarID, closureVars
|
|||
return dvar
|
||||
}
|
||||
|
||||
// createHeapDerefLocationList creates a location list for a heap-escaped variable
|
||||
// that describes "dereference pointer at stack offset"
|
||||
func createHeapDerefLocationList(n *ir.Name, entryID ssa.ID) []byte {
|
||||
// Get the stack offset where the heap pointer is stored
|
||||
heapPtrOffset := n.Heapaddr.FrameOffset()
|
||||
if base.Ctxt.Arch.FixedFrameSize == 0 {
|
||||
heapPtrOffset -= int64(types.PtrSize)
|
||||
}
|
||||
if buildcfg.FramePointerEnabled {
|
||||
heapPtrOffset -= int64(types.PtrSize)
|
||||
}
|
||||
|
||||
// Create a location expression: DW_OP_fbreg <offset> DW_OP_deref
|
||||
var locExpr []byte
|
||||
var sizeIdx int
|
||||
locExpr, sizeIdx = ssa.SetupLocList(base.Ctxt, entryID, locExpr, ssa.BlockStart.ID, ssa.FuncEnd.ID)
|
||||
locExpr = append(locExpr, dwarf.DW_OP_fbreg)
|
||||
locExpr = dwarf.AppendSleb128(locExpr, heapPtrOffset)
|
||||
locExpr = append(locExpr, dwarf.DW_OP_deref)
|
||||
base.Ctxt.Arch.ByteOrder.PutUint16(locExpr[sizeIdx:], uint16(len(locExpr)-sizeIdx-2))
|
||||
return locExpr
|
||||
}
|
||||
|
||||
// RecordFlags records the specified command-line flags to be placed
|
||||
// in the DWARF info.
|
||||
func RecordFlags(flags ...string) {
|
||||
if base.Ctxt.Pkgpath == "" {
|
||||
panic("missing pkgpath")
|
||||
base.Fatalf("missing pkgpath")
|
||||
}
|
||||
|
||||
type BoolFlag interface {
|
||||
|
|
|
|||
|
|
@ -192,7 +192,7 @@ func (e *escape) call(ks []hole, call ir.Node) {
|
|||
e.discard(call.X)
|
||||
e.discard(call.Y)
|
||||
|
||||
case ir.ODELETE, ir.OPRINT, ir.OPRINTLN, ir.ORECOVERFP:
|
||||
case ir.ODELETE, ir.OPRINT, ir.OPRINTLN, ir.ORECOVER:
|
||||
call := call.(*ir.CallExpr)
|
||||
for _, arg := range call.Args {
|
||||
e.discard(arg)
|
||||
|
|
|
|||
|
|
@ -122,17 +122,24 @@ type escape struct {
|
|||
}
|
||||
|
||||
func Funcs(all []*ir.Func) {
|
||||
ir.VisitFuncsBottomUp(all, Batch)
|
||||
// Make a cache of ir.ReassignOracles. The cache is lazily populated.
|
||||
// TODO(thepudds): consider adding a field on ir.Func instead. We might also be able
|
||||
// to use that field elsewhere, like in walk. See discussion in https://go.dev/cl/688075.
|
||||
reassignOracles := make(map[*ir.Func]*ir.ReassignOracle)
|
||||
|
||||
ir.VisitFuncsBottomUp(all, func(list []*ir.Func, recursive bool) {
|
||||
Batch(list, reassignOracles)
|
||||
})
|
||||
}
|
||||
|
||||
// Batch performs escape analysis on a minimal batch of
|
||||
// functions.
|
||||
func Batch(fns []*ir.Func, recursive bool) {
|
||||
func Batch(fns []*ir.Func, reassignOracles map[*ir.Func]*ir.ReassignOracle) {
|
||||
var b batch
|
||||
b.heapLoc.attrs = attrEscapes | attrPersists | attrMutates | attrCalls
|
||||
b.mutatorLoc.attrs = attrMutates
|
||||
b.calleeLoc.attrs = attrCalls
|
||||
b.reassignOracles = make(map[*ir.Func]*ir.ReassignOracle)
|
||||
b.reassignOracles = reassignOracles
|
||||
|
||||
// Construct data-flow graph from syntax trees.
|
||||
for _, fn := range fns {
|
||||
|
|
@ -531,19 +538,9 @@ func (b *batch) rewriteWithLiterals(n ir.Node, fn *ir.Func) {
|
|||
if n == nil || fn == nil {
|
||||
return
|
||||
}
|
||||
if n.Op() != ir.OMAKESLICE && n.Op() != ir.OCONVIFACE {
|
||||
return
|
||||
}
|
||||
|
||||
// Look up a cached ReassignOracle for the function, lazily computing one if needed.
|
||||
ro := b.reassignOracle(fn)
|
||||
if ro == nil {
|
||||
base.Fatalf("no ReassignOracle for function %v with closure parent %v", fn, fn.ClosureParent)
|
||||
}
|
||||
|
||||
assignTemp := func(n ir.Node, init *ir.Nodes) {
|
||||
assignTemp := func(pos src.XPos, n ir.Node, init *ir.Nodes) {
|
||||
// Preserve any side effects of n by assigning it to an otherwise unused temp.
|
||||
pos := n.Pos()
|
||||
tmp := typecheck.TempAt(pos, fn, n.Type())
|
||||
init.Append(typecheck.Stmt(ir.NewDecl(pos, ir.ODCL, tmp)))
|
||||
init.Append(typecheck.Stmt(ir.NewAssignStmt(pos, tmp, n)))
|
||||
|
|
@ -561,6 +558,11 @@ func (b *batch) rewriteWithLiterals(n ir.Node, fn *ir.Func) {
|
|||
}
|
||||
|
||||
if (*r).Op() != ir.OLITERAL {
|
||||
// Look up a cached ReassignOracle for the function, lazily computing one if needed.
|
||||
ro := b.reassignOracle(fn)
|
||||
if ro == nil {
|
||||
base.Fatalf("no ReassignOracle for function %v with closure parent %v", fn, fn.ClosureParent)
|
||||
}
|
||||
if s := ro.StaticValue(*r); s.Op() == ir.OLITERAL {
|
||||
lit, ok := s.(*ir.BasicLit)
|
||||
if !ok || lit.Val().Kind() != constant.Int {
|
||||
|
|
@ -572,8 +574,8 @@ func (b *batch) rewriteWithLiterals(n ir.Node, fn *ir.Func) {
|
|||
return
|
||||
}
|
||||
// Preserve any side effects of the original expression, then replace it.
|
||||
assignTemp(*r, n.PtrInit())
|
||||
*r = lit
|
||||
assignTemp(n.Pos(), *r, n.PtrInit())
|
||||
*r = ir.NewBasicLit(n.Pos(), (*r).Type(), lit.Val())
|
||||
}
|
||||
}
|
||||
}
|
||||
|
|
@ -582,6 +584,12 @@ func (b *batch) rewriteWithLiterals(n ir.Node, fn *ir.Func) {
|
|||
// a literal to avoid heap allocating the underlying interface value.
|
||||
conv := n.(*ir.ConvExpr)
|
||||
if conv.X.Op() != ir.OLITERAL && !conv.X.Type().IsInterface() {
|
||||
// TODO(thepudds): likely could avoid some work by tightening the check of conv.X's type.
|
||||
// Look up a cached ReassignOracle for the function, lazily computing one if needed.
|
||||
ro := b.reassignOracle(fn)
|
||||
if ro == nil {
|
||||
base.Fatalf("no ReassignOracle for function %v with closure parent %v", fn, fn.ClosureParent)
|
||||
}
|
||||
v := ro.StaticValue(conv.X)
|
||||
if v != nil && v.Op() == ir.OLITERAL && ir.ValidTypeForConst(conv.X.Type(), v.Val()) {
|
||||
if !base.LiteralAllocHash.MatchPos(n.Pos(), nil) {
|
||||
|
|
@ -592,9 +600,9 @@ func (b *batch) rewriteWithLiterals(n ir.Node, fn *ir.Func) {
|
|||
base.WarnfAt(n.Pos(), "rewriting OCONVIFACE value from %v (%v) to %v (%v)", conv.X, conv.X.Type(), v, v.Type())
|
||||
}
|
||||
// Preserve any side effects of the original expression, then replace it.
|
||||
assignTemp(conv.X, conv.PtrInit())
|
||||
assignTemp(conv.Pos(), conv.X, conv.PtrInit())
|
||||
v := v.(*ir.BasicLit)
|
||||
conv.X = ir.NewBasicLit(conv.X.Pos(), conv.X.Type(), v.Val())
|
||||
conv.X = ir.NewBasicLit(conv.Pos(), conv.X.Type(), v.Val())
|
||||
typecheck.Expr(conv)
|
||||
}
|
||||
}
|
||||
|
|
|
|||
|
|
@ -139,7 +139,7 @@ func (e *escape) exprSkipInit(k hole, n ir.Node) {
|
|||
e.discard(n.X)
|
||||
|
||||
case ir.OCALLMETH, ir.OCALLFUNC, ir.OCALLINTER, ir.OINLCALL,
|
||||
ir.OLEN, ir.OCAP, ir.OMIN, ir.OMAX, ir.OCOMPLEX, ir.OREAL, ir.OIMAG, ir.OAPPEND, ir.OCOPY, ir.ORECOVERFP,
|
||||
ir.OLEN, ir.OCAP, ir.OMIN, ir.OMAX, ir.OCOMPLEX, ir.OREAL, ir.OIMAG, ir.OAPPEND, ir.OCOPY, ir.ORECOVER,
|
||||
ir.OUNSAFEADD, ir.OUNSAFESLICE, ir.OUNSAFESTRING, ir.OUNSAFESTRINGDATA, ir.OUNSAFESLICEDATA:
|
||||
e.call([]hole{k}, n)
|
||||
|
||||
|
|
|
|||
|
|
@ -183,7 +183,7 @@ func (e *escape) stmt(n ir.Node) {
|
|||
dsts[i] = res.Nname.(*ir.Name)
|
||||
}
|
||||
e.assignList(dsts, n.Results, "return", n)
|
||||
case ir.OCALLFUNC, ir.OCALLMETH, ir.OCALLINTER, ir.OINLCALL, ir.OCLEAR, ir.OCLOSE, ir.OCOPY, ir.ODELETE, ir.OPANIC, ir.OPRINT, ir.OPRINTLN, ir.ORECOVERFP:
|
||||
case ir.OCALLFUNC, ir.OCALLMETH, ir.OCALLINTER, ir.OINLCALL, ir.OCLEAR, ir.OCLOSE, ir.OCOPY, ir.ODELETE, ir.OPANIC, ir.OPRINT, ir.OPRINTLN, ir.ORECOVER:
|
||||
e.call(nil, n)
|
||||
case ir.OGO, ir.ODEFER:
|
||||
n := n.(*ir.GoDeferStmt)
|
||||
|
|
|
|||
|
|
@ -104,12 +104,10 @@ func Main(archInit func(*ssagen.ArchInfo)) {
|
|||
ir.Pkgs.Runtime = types.NewPkg("go.runtime", "runtime")
|
||||
ir.Pkgs.Runtime.Prefix = "runtime"
|
||||
|
||||
if buildcfg.Experiment.SwissMap {
|
||||
// Pseudo-package that contains the compiler's builtin
|
||||
// declarations for maps.
|
||||
ir.Pkgs.InternalMaps = types.NewPkg("go.internal/runtime/maps", "internal/runtime/maps")
|
||||
ir.Pkgs.InternalMaps.Prefix = "internal/runtime/maps"
|
||||
}
|
||||
// Pseudo-package that contains the compiler's builtin
|
||||
// declarations for maps.
|
||||
ir.Pkgs.InternalMaps = types.NewPkg("go.internal/runtime/maps", "internal/runtime/maps")
|
||||
ir.Pkgs.InternalMaps.Prefix = "internal/runtime/maps"
|
||||
|
||||
// pseudo-packages used in symbol tables
|
||||
ir.Pkgs.Itab = types.NewPkg("go.itab", "go.itab")
|
||||
|
|
|
|||
|
|
@ -673,3 +673,50 @@ type S struct {
|
|||
}
|
||||
wg.Wait()
|
||||
}
|
||||
|
||||
func TestIssue63285(t *testing.T) {
|
||||
testenv.MustHaveGoBuild(t)
|
||||
|
||||
// This package only handles gc export data.
|
||||
if runtime.Compiler != "gc" {
|
||||
t.Skipf("gc-built packages not available (compiler = %s)", runtime.Compiler)
|
||||
}
|
||||
|
||||
tmpdir := t.TempDir()
|
||||
testoutdir := filepath.Join(tmpdir, "testdata")
|
||||
if err := os.Mkdir(testoutdir, 0700); err != nil {
|
||||
t.Fatalf("making output dir: %v", err)
|
||||
}
|
||||
|
||||
compile(t, "testdata", "issue63285.go", testoutdir, nil)
|
||||
|
||||
issue63285, err := Import(make(map[string]*types2.Package), "./testdata/issue63285", tmpdir, nil)
|
||||
if err != nil {
|
||||
t.Fatal(err)
|
||||
}
|
||||
|
||||
check := func(pkgname, src string, imports importMap) (*types2.Package, error) {
|
||||
f, err := syntax.Parse(syntax.NewFileBase(pkgname), strings.NewReader(src), nil, nil, 0)
|
||||
if err != nil {
|
||||
return nil, err
|
||||
}
|
||||
config := &types2.Config{
|
||||
Importer: imports,
|
||||
}
|
||||
return config.Check(pkgname, []*syntax.File{f}, nil)
|
||||
}
|
||||
|
||||
const pSrc = `package p
|
||||
|
||||
import "issue63285"
|
||||
|
||||
var _ issue63285.A[issue63285.B[any]]
|
||||
`
|
||||
|
||||
importer := importMap{
|
||||
"issue63285": issue63285,
|
||||
}
|
||||
if _, err := check("p", pSrc, importer); err != nil {
|
||||
t.Errorf("Check failed: %v", err)
|
||||
}
|
||||
}
|
||||
|
|
|
|||
11
src/cmd/compile/internal/importer/testdata/issue63285.go
vendored
Normal file
11
src/cmd/compile/internal/importer/testdata/issue63285.go
vendored
Normal file
|
|
@ -0,0 +1,11 @@
|
|||
// Copyright 2025 The Go Authors. All rights reserved.
|
||||
// Use of this source code is governed by a BSD-style
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
package issue63285
|
||||
|
||||
type A[_ B[any]] struct{}
|
||||
|
||||
type B[_ any] interface {
|
||||
f() A[B[any]]
|
||||
}
|
||||
|
|
@ -67,7 +67,8 @@ type reader struct {
|
|||
|
||||
p *pkgReader
|
||||
|
||||
dict *readerDict
|
||||
dict *readerDict
|
||||
delayed []func()
|
||||
}
|
||||
|
||||
type readerDict struct {
|
||||
|
|
@ -420,7 +421,7 @@ func (pr *pkgReader) objIdx(idx pkgbits.Index) (*types2.Package, string) {
|
|||
pos := r.pos()
|
||||
var tparams []*types2.TypeParam
|
||||
if r.Version().Has(pkgbits.AliasTypeParamNames) {
|
||||
tparams = r.typeParamNames()
|
||||
tparams = r.typeParamNames(false)
|
||||
}
|
||||
typ := r.typ()
|
||||
return newAliasTypeName(pr.enableAlias, pos, objPkg, objName, typ, tparams)
|
||||
|
|
@ -433,28 +434,28 @@ func (pr *pkgReader) objIdx(idx pkgbits.Index) (*types2.Package, string) {
|
|||
|
||||
case pkgbits.ObjFunc:
|
||||
pos := r.pos()
|
||||
tparams := r.typeParamNames()
|
||||
tparams := r.typeParamNames(false)
|
||||
sig := r.signature(nil, nil, tparams)
|
||||
return types2.NewFunc(pos, objPkg, objName, sig)
|
||||
|
||||
case pkgbits.ObjType:
|
||||
pos := r.pos()
|
||||
|
||||
return types2.NewTypeNameLazy(pos, objPkg, objName, func(named *types2.Named) (tparams []*types2.TypeParam, underlying types2.Type, methods []*types2.Func) {
|
||||
tparams = r.typeParamNames()
|
||||
return types2.NewTypeNameLazy(pos, objPkg, objName, func(_ *types2.Named) ([]*types2.TypeParam, types2.Type, []*types2.Func, []func()) {
|
||||
tparams := r.typeParamNames(true)
|
||||
|
||||
// TODO(mdempsky): Rewrite receiver types to underlying is an
|
||||
// Interface? The go/types importer does this (I think because
|
||||
// unit tests expected that), but cmd/compile doesn't care
|
||||
// about it, so maybe we can avoid worrying about that here.
|
||||
underlying = r.typ().Underlying()
|
||||
underlying := r.typ().Underlying()
|
||||
|
||||
methods = make([]*types2.Func, r.Len())
|
||||
methods := make([]*types2.Func, r.Len())
|
||||
for i := range methods {
|
||||
methods[i] = r.method()
|
||||
methods[i] = r.method(true)
|
||||
}
|
||||
|
||||
return
|
||||
return tparams, underlying, methods, r.delayed
|
||||
})
|
||||
|
||||
case pkgbits.ObjVar:
|
||||
|
|
@ -497,7 +498,7 @@ func (pr *pkgReader) objDictIdx(idx pkgbits.Index) *readerDict {
|
|||
return &dict
|
||||
}
|
||||
|
||||
func (r *reader) typeParamNames() []*types2.TypeParam {
|
||||
func (r *reader) typeParamNames(isLazy bool) []*types2.TypeParam {
|
||||
r.Sync(pkgbits.SyncTypeParamNames)
|
||||
|
||||
// Note: This code assumes it only processes objects without
|
||||
|
|
@ -523,19 +524,38 @@ func (r *reader) typeParamNames() []*types2.TypeParam {
|
|||
r.dict.tparams[i] = types2.NewTypeParam(tname, nil)
|
||||
}
|
||||
|
||||
for i, bound := range r.dict.bounds {
|
||||
r.dict.tparams[i].SetConstraint(r.p.typIdx(bound, r.dict))
|
||||
// Type parameters that are read by lazy loaders cannot have their
|
||||
// constraints set eagerly; do them after loading (go.dev/issue/63285).
|
||||
if isLazy {
|
||||
// The reader dictionary will continue mutating before we have time
|
||||
// to call delayed functions; must make a local copy of both the type
|
||||
// parameters and their (unexpanded) constraints.
|
||||
bounds := make([]types2.Type, len(r.dict.bounds))
|
||||
for i, bound := range r.dict.bounds {
|
||||
bounds[i] = r.p.typIdx(bound, r.dict)
|
||||
}
|
||||
|
||||
tparams := r.dict.tparams
|
||||
r.delayed = append(r.delayed, func() {
|
||||
for i, bound := range bounds {
|
||||
tparams[i].SetConstraint(bound)
|
||||
}
|
||||
})
|
||||
} else {
|
||||
for i, bound := range r.dict.bounds {
|
||||
r.dict.tparams[i].SetConstraint(r.p.typIdx(bound, r.dict))
|
||||
}
|
||||
}
|
||||
|
||||
return r.dict.tparams
|
||||
}
|
||||
|
||||
func (r *reader) method() *types2.Func {
|
||||
func (r *reader) method(isLazy bool) *types2.Func {
|
||||
r.Sync(pkgbits.SyncMethod)
|
||||
pos := r.pos()
|
||||
pkg, name := r.selector()
|
||||
|
||||
rtparams := r.typeParamNames()
|
||||
rtparams := r.typeParamNames(isLazy)
|
||||
sig := r.signature(r.param(), rtparams, nil)
|
||||
|
||||
_ = r.pos() // TODO(mdempsky): Remove; this is a hacker for linker.go.
|
||||
|
|
|
|||
|
|
@ -605,10 +605,7 @@ opSwitch:
|
|||
v.budget -= inlineExtraPanicCost
|
||||
|
||||
case ir.ORECOVER:
|
||||
base.FatalfAt(n.Pos(), "ORECOVER missed typecheck")
|
||||
case ir.ORECOVERFP:
|
||||
// recover matches the argument frame pointer to find
|
||||
// the right panic value, so it needs an argument frame.
|
||||
// TODO: maybe we could allow inlining of recover() now?
|
||||
v.reason = "call to recover"
|
||||
return true
|
||||
|
||||
|
|
|
|||
|
|
@ -335,7 +335,7 @@ func (ffa *funcFlagsAnalyzer) nodeVisitPost(n ir.Node) {
|
|||
ir.OPRINTLN, ir.OPRINT, ir.OLABEL, ir.OCALLINTER, ir.ODEFER,
|
||||
ir.OSEND, ir.ORECV, ir.OSELRECV2, ir.OGO, ir.OAPPEND, ir.OAS2DOTTYPE,
|
||||
ir.OAS2MAPR, ir.OGETG, ir.ODELETE, ir.OINLMARK, ir.OAS2RECV,
|
||||
ir.OMIN, ir.OMAX, ir.OMAKE, ir.ORECOVERFP, ir.OGETCALLERSP:
|
||||
ir.OMIN, ir.OMAX, ir.OMAKE, ir.OGETCALLERSP:
|
||||
// these should all be benign/uninteresting
|
||||
case ir.OTAILCALL, ir.OJUMPTABLE, ir.OTYPESW:
|
||||
// don't expect to see these at all.
|
||||
|
|
|
|||
|
|
@ -213,7 +213,7 @@ func (n *CallExpr) SetOp(op Op) {
|
|||
ODELETE,
|
||||
OGETG, OGETCALLERSP,
|
||||
OMAKE, OMAX, OMIN, OPRINT, OPRINTLN,
|
||||
ORECOVER, ORECOVERFP:
|
||||
ORECOVER:
|
||||
n.op = op
|
||||
}
|
||||
}
|
||||
|
|
@ -912,12 +912,12 @@ FindRHS:
|
|||
break FindRHS
|
||||
}
|
||||
}
|
||||
base.Fatalf("%v missing from LHS of %v", n, defn)
|
||||
base.FatalfAt(defn.Pos(), "%v missing from LHS of %v", n, defn)
|
||||
default:
|
||||
return nil
|
||||
}
|
||||
if rhs == nil {
|
||||
base.Fatalf("RHS is nil: %v", defn)
|
||||
base.FatalfAt(defn.Pos(), "RHS is nil: %v", defn)
|
||||
}
|
||||
|
||||
if Reassigned(n) {
|
||||
|
|
|
|||
|
|
@ -234,7 +234,6 @@ const (
|
|||
OSLICEHEADER // sliceheader{Ptr, Len, Cap} (Ptr is unsafe.Pointer, Len is length, Cap is capacity)
|
||||
OSTRINGHEADER // stringheader{Ptr, Len} (Ptr is unsafe.Pointer, Len is length)
|
||||
ORECOVER // recover()
|
||||
ORECOVERFP // recover(Args) w/ explicit FP argument
|
||||
ORECV // <-X
|
||||
ORUNESTR // Type(X) (Type is string, X is rune)
|
||||
OSELRECV2 // like OAS2: Lhs = Rhs where len(Lhs)=2, len(Rhs)=1, Rhs[0].Op = ORECV (appears as .Var of OCASE)
|
||||
|
|
|
|||
|
|
@ -108,62 +108,61 @@ func _() {
|
|||
_ = x[OSLICEHEADER-97]
|
||||
_ = x[OSTRINGHEADER-98]
|
||||
_ = x[ORECOVER-99]
|
||||
_ = x[ORECOVERFP-100]
|
||||
_ = x[ORECV-101]
|
||||
_ = x[ORUNESTR-102]
|
||||
_ = x[OSELRECV2-103]
|
||||
_ = x[OMIN-104]
|
||||
_ = x[OMAX-105]
|
||||
_ = x[OREAL-106]
|
||||
_ = x[OIMAG-107]
|
||||
_ = x[OCOMPLEX-108]
|
||||
_ = x[OUNSAFEADD-109]
|
||||
_ = x[OUNSAFESLICE-110]
|
||||
_ = x[OUNSAFESLICEDATA-111]
|
||||
_ = x[OUNSAFESTRING-112]
|
||||
_ = x[OUNSAFESTRINGDATA-113]
|
||||
_ = x[OMETHEXPR-114]
|
||||
_ = x[OMETHVALUE-115]
|
||||
_ = x[OBLOCK-116]
|
||||
_ = x[OBREAK-117]
|
||||
_ = x[OCASE-118]
|
||||
_ = x[OCONTINUE-119]
|
||||
_ = x[ODEFER-120]
|
||||
_ = x[OFALL-121]
|
||||
_ = x[OFOR-122]
|
||||
_ = x[OGOTO-123]
|
||||
_ = x[OIF-124]
|
||||
_ = x[OLABEL-125]
|
||||
_ = x[OGO-126]
|
||||
_ = x[ORANGE-127]
|
||||
_ = x[ORETURN-128]
|
||||
_ = x[OSELECT-129]
|
||||
_ = x[OSWITCH-130]
|
||||
_ = x[OTYPESW-131]
|
||||
_ = x[OINLCALL-132]
|
||||
_ = x[OMAKEFACE-133]
|
||||
_ = x[OITAB-134]
|
||||
_ = x[OIDATA-135]
|
||||
_ = x[OSPTR-136]
|
||||
_ = x[OCFUNC-137]
|
||||
_ = x[OCHECKNIL-138]
|
||||
_ = x[ORESULT-139]
|
||||
_ = x[OINLMARK-140]
|
||||
_ = x[OLINKSYMOFFSET-141]
|
||||
_ = x[OJUMPTABLE-142]
|
||||
_ = x[OINTERFACESWITCH-143]
|
||||
_ = x[ODYNAMICDOTTYPE-144]
|
||||
_ = x[ODYNAMICDOTTYPE2-145]
|
||||
_ = x[ODYNAMICTYPE-146]
|
||||
_ = x[OTAILCALL-147]
|
||||
_ = x[OGETG-148]
|
||||
_ = x[OGETCALLERSP-149]
|
||||
_ = x[OEND-150]
|
||||
_ = x[ORECV-100]
|
||||
_ = x[ORUNESTR-101]
|
||||
_ = x[OSELRECV2-102]
|
||||
_ = x[OMIN-103]
|
||||
_ = x[OMAX-104]
|
||||
_ = x[OREAL-105]
|
||||
_ = x[OIMAG-106]
|
||||
_ = x[OCOMPLEX-107]
|
||||
_ = x[OUNSAFEADD-108]
|
||||
_ = x[OUNSAFESLICE-109]
|
||||
_ = x[OUNSAFESLICEDATA-110]
|
||||
_ = x[OUNSAFESTRING-111]
|
||||
_ = x[OUNSAFESTRINGDATA-112]
|
||||
_ = x[OMETHEXPR-113]
|
||||
_ = x[OMETHVALUE-114]
|
||||
_ = x[OBLOCK-115]
|
||||
_ = x[OBREAK-116]
|
||||
_ = x[OCASE-117]
|
||||
_ = x[OCONTINUE-118]
|
||||
_ = x[ODEFER-119]
|
||||
_ = x[OFALL-120]
|
||||
_ = x[OFOR-121]
|
||||
_ = x[OGOTO-122]
|
||||
_ = x[OIF-123]
|
||||
_ = x[OLABEL-124]
|
||||
_ = x[OGO-125]
|
||||
_ = x[ORANGE-126]
|
||||
_ = x[ORETURN-127]
|
||||
_ = x[OSELECT-128]
|
||||
_ = x[OSWITCH-129]
|
||||
_ = x[OTYPESW-130]
|
||||
_ = x[OINLCALL-131]
|
||||
_ = x[OMAKEFACE-132]
|
||||
_ = x[OITAB-133]
|
||||
_ = x[OIDATA-134]
|
||||
_ = x[OSPTR-135]
|
||||
_ = x[OCFUNC-136]
|
||||
_ = x[OCHECKNIL-137]
|
||||
_ = x[ORESULT-138]
|
||||
_ = x[OINLMARK-139]
|
||||
_ = x[OLINKSYMOFFSET-140]
|
||||
_ = x[OJUMPTABLE-141]
|
||||
_ = x[OINTERFACESWITCH-142]
|
||||
_ = x[ODYNAMICDOTTYPE-143]
|
||||
_ = x[ODYNAMICDOTTYPE2-144]
|
||||
_ = x[ODYNAMICTYPE-145]
|
||||
_ = x[OTAILCALL-146]
|
||||
_ = x[OGETG-147]
|
||||
_ = x[OGETCALLERSP-148]
|
||||
_ = x[OEND-149]
|
||||
}
|
||||
|
||||
const _Op_name = "XXXNAMENONAMETYPELITERALNILADDSUBORXORADDSTRADDRANDANDAPPENDBYTES2STRBYTES2STRTMPRUNES2STRSTR2BYTESSTR2BYTESTMPSTR2RUNESSLICE2ARRSLICE2ARRPTRASAS2AS2DOTTYPEAS2FUNCAS2MAPRAS2RECVASOPCALLCALLFUNCCALLMETHCALLINTERCAPCLEARCLOSECLOSURECOMPLITMAPLITSTRUCTLITARRAYLITSLICELITPTRLITCONVCONVIFACECONVNOPCOPYDCLDCLFUNCDELETEDOTDOTPTRDOTMETHDOTINTERXDOTDOTTYPEDOTTYPE2EQNELTLEGEGTDEREFINDEXINDEXMAPKEYSTRUCTKEYLENMAKEMAKECHANMAKEMAPMAKESLICEMAKESLICECOPYMULDIVMODLSHRSHANDANDNOTNEWNOTBITNOTPLUSNEGORORPANICPRINTPRINTLNPARENSENDSLICESLICEARRSLICESTRSLICE3SLICE3ARRSLICEHEADERSTRINGHEADERRECOVERRECOVERFPRECVRUNESTRSELRECV2MINMAXREALIMAGCOMPLEXUNSAFEADDUNSAFESLICEUNSAFESLICEDATAUNSAFESTRINGUNSAFESTRINGDATAMETHEXPRMETHVALUEBLOCKBREAKCASECONTINUEDEFERFALLFORGOTOIFLABELGORANGERETURNSELECTSWITCHTYPESWINLCALLMAKEFACEITABIDATASPTRCFUNCCHECKNILRESULTINLMARKLINKSYMOFFSETJUMPTABLEINTERFACESWITCHDYNAMICDOTTYPEDYNAMICDOTTYPE2DYNAMICTYPETAILCALLGETGGETCALLERSPEND"
|
||||
const _Op_name = "XXXNAMENONAMETYPELITERALNILADDSUBORXORADDSTRADDRANDANDAPPENDBYTES2STRBYTES2STRTMPRUNES2STRSTR2BYTESSTR2BYTESTMPSTR2RUNESSLICE2ARRSLICE2ARRPTRASAS2AS2DOTTYPEAS2FUNCAS2MAPRAS2RECVASOPCALLCALLFUNCCALLMETHCALLINTERCAPCLEARCLOSECLOSURECOMPLITMAPLITSTRUCTLITARRAYLITSLICELITPTRLITCONVCONVIFACECONVNOPCOPYDCLDCLFUNCDELETEDOTDOTPTRDOTMETHDOTINTERXDOTDOTTYPEDOTTYPE2EQNELTLEGEGTDEREFINDEXINDEXMAPKEYSTRUCTKEYLENMAKEMAKECHANMAKEMAPMAKESLICEMAKESLICECOPYMULDIVMODLSHRSHANDANDNOTNEWNOTBITNOTPLUSNEGORORPANICPRINTPRINTLNPARENSENDSLICESLICEARRSLICESTRSLICE3SLICE3ARRSLICEHEADERSTRINGHEADERRECOVERRECVRUNESTRSELRECV2MINMAXREALIMAGCOMPLEXUNSAFEADDUNSAFESLICEUNSAFESLICEDATAUNSAFESTRINGUNSAFESTRINGDATAMETHEXPRMETHVALUEBLOCKBREAKCASECONTINUEDEFERFALLFORGOTOIFLABELGORANGERETURNSELECTSWITCHTYPESWINLCALLMAKEFACEITABIDATASPTRCFUNCCHECKNILRESULTINLMARKLINKSYMOFFSETJUMPTABLEINTERFACESWITCHDYNAMICDOTTYPEDYNAMICDOTTYPE2DYNAMICTYPETAILCALLGETGGETCALLERSPEND"
|
||||
|
||||
var _Op_index = [...]uint16{0, 3, 7, 13, 17, 24, 27, 30, 33, 35, 38, 44, 48, 54, 60, 69, 81, 90, 99, 111, 120, 129, 141, 143, 146, 156, 163, 170, 177, 181, 185, 193, 201, 210, 213, 218, 223, 230, 237, 243, 252, 260, 268, 274, 278, 287, 294, 298, 301, 308, 314, 317, 323, 330, 338, 342, 349, 357, 359, 361, 363, 365, 367, 369, 374, 379, 387, 390, 399, 402, 406, 414, 421, 430, 443, 446, 449, 452, 455, 458, 461, 467, 470, 473, 479, 483, 486, 490, 495, 500, 507, 512, 516, 521, 529, 537, 543, 552, 563, 575, 582, 591, 595, 602, 610, 613, 616, 620, 624, 631, 640, 651, 666, 678, 694, 702, 711, 716, 721, 725, 733, 738, 742, 745, 749, 751, 756, 758, 763, 769, 775, 781, 787, 794, 802, 806, 811, 815, 820, 828, 834, 841, 854, 863, 878, 892, 907, 918, 926, 930, 941, 944}
|
||||
var _Op_index = [...]uint16{0, 3, 7, 13, 17, 24, 27, 30, 33, 35, 38, 44, 48, 54, 60, 69, 81, 90, 99, 111, 120, 129, 141, 143, 146, 156, 163, 170, 177, 181, 185, 193, 201, 210, 213, 218, 223, 230, 237, 243, 252, 260, 268, 274, 278, 287, 294, 298, 301, 308, 314, 317, 323, 330, 338, 342, 349, 357, 359, 361, 363, 365, 367, 369, 374, 379, 387, 390, 399, 402, 406, 414, 421, 430, 443, 446, 449, 452, 455, 458, 461, 467, 470, 473, 479, 483, 486, 490, 495, 500, 507, 512, 516, 521, 529, 537, 543, 552, 563, 575, 582, 586, 593, 601, 604, 607, 611, 615, 622, 631, 642, 657, 669, 685, 693, 702, 707, 712, 716, 724, 729, 733, 736, 740, 742, 747, 749, 754, 760, 766, 772, 778, 785, 793, 797, 802, 806, 811, 819, 825, 832, 845, 854, 869, 883, 898, 909, 917, 921, 932, 935}
|
||||
|
||||
func (i Op) String() string {
|
||||
if i >= Op(len(_Op_index)-1) {
|
||||
|
|
|
|||
|
|
@ -178,12 +178,12 @@ FindRHS:
|
|||
break FindRHS
|
||||
}
|
||||
}
|
||||
base.Fatalf("%v missing from LHS of %v", n, defn)
|
||||
base.FatalfAt(defn.Pos(), "%v missing from LHS of %v", n, defn)
|
||||
default:
|
||||
return nil
|
||||
}
|
||||
if rhs == nil {
|
||||
base.Fatalf("RHS is nil: %v", defn)
|
||||
base.FatalfAt(defn.Pos(), "RHS is nil: %v", defn)
|
||||
}
|
||||
|
||||
if _, ok := ro.singleDef[n]; !ok {
|
||||
|
|
|
|||
|
|
@ -37,6 +37,8 @@ type symsStruct struct {
|
|||
Msanmove *obj.LSym
|
||||
Newobject *obj.LSym
|
||||
Newproc *obj.LSym
|
||||
PanicBounds *obj.LSym
|
||||
PanicExtend *obj.LSym
|
||||
Panicdivide *obj.LSym
|
||||
Panicshift *obj.LSym
|
||||
PanicdottypeE *obj.LSym
|
||||
|
|
|
|||
|
|
@ -769,7 +769,7 @@ func (lv *Liveness) epilogue() {
|
|||
// its stack copy is not live.
|
||||
continue
|
||||
}
|
||||
// Note: zeroing is handled by zeroResults in walk.go.
|
||||
// Note: zeroing is handled by zeroResults in ../ssagen/ssa.go.
|
||||
livedefer.Set(int32(i))
|
||||
}
|
||||
if n.IsOutputParamHeapAddr() {
|
||||
|
|
|
|||
|
|
@ -16,6 +16,7 @@ import (
|
|||
"cmd/compile/internal/types"
|
||||
"cmd/internal/obj"
|
||||
"cmd/internal/obj/loong64"
|
||||
"internal/abi"
|
||||
)
|
||||
|
||||
// isFPreg reports whether r is an FP register.
|
||||
|
|
@ -663,12 +664,92 @@ func ssaGenValue(s *ssagen.State, v *ssa.Value) {
|
|||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = 0x1A
|
||||
|
||||
case ssa.OpLOONG64LoweredPanicBoundsA, ssa.OpLOONG64LoweredPanicBoundsB, ssa.OpLOONG64LoweredPanicBoundsC:
|
||||
p := s.Prog(obj.ACALL)
|
||||
case ssa.OpLOONG64LoweredPanicBoundsRR, ssa.OpLOONG64LoweredPanicBoundsRC, ssa.OpLOONG64LoweredPanicBoundsCR, ssa.OpLOONG64LoweredPanicBoundsCC:
|
||||
// Compute the constant we put in the PCData entry for this call.
|
||||
code, signed := ssa.BoundsKind(v.AuxInt).Code()
|
||||
xIsReg := false
|
||||
yIsReg := false
|
||||
xVal := 0
|
||||
yVal := 0
|
||||
switch v.Op {
|
||||
case ssa.OpLOONG64LoweredPanicBoundsRR:
|
||||
xIsReg = true
|
||||
xVal = int(v.Args[0].Reg() - loong64.REG_R4)
|
||||
yIsReg = true
|
||||
yVal = int(v.Args[1].Reg() - loong64.REG_R4)
|
||||
case ssa.OpLOONG64LoweredPanicBoundsRC:
|
||||
xIsReg = true
|
||||
xVal = int(v.Args[0].Reg() - loong64.REG_R4)
|
||||
c := v.Aux.(ssa.PanicBoundsC).C
|
||||
if c >= 0 && c <= abi.BoundsMaxConst {
|
||||
yVal = int(c)
|
||||
} else {
|
||||
// Move constant to a register
|
||||
yIsReg = true
|
||||
if yVal == xVal {
|
||||
yVal = 1
|
||||
}
|
||||
p := s.Prog(loong64.AMOVV)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = loong64.REG_R4 + int16(yVal)
|
||||
}
|
||||
case ssa.OpLOONG64LoweredPanicBoundsCR:
|
||||
yIsReg = true
|
||||
yVal := int(v.Args[0].Reg() - loong64.REG_R4)
|
||||
c := v.Aux.(ssa.PanicBoundsC).C
|
||||
if c >= 0 && c <= abi.BoundsMaxConst {
|
||||
xVal = int(c)
|
||||
} else {
|
||||
// Move constant to a register
|
||||
xIsReg = true
|
||||
if xVal == yVal {
|
||||
xVal = 1
|
||||
}
|
||||
p := s.Prog(loong64.AMOVV)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = loong64.REG_R4 + int16(xVal)
|
||||
}
|
||||
case ssa.OpLOONG64LoweredPanicBoundsCC:
|
||||
c := v.Aux.(ssa.PanicBoundsCC).Cx
|
||||
if c >= 0 && c <= abi.BoundsMaxConst {
|
||||
xVal = int(c)
|
||||
} else {
|
||||
// Move constant to a register
|
||||
xIsReg = true
|
||||
p := s.Prog(loong64.AMOVV)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = loong64.REG_R4 + int16(xVal)
|
||||
}
|
||||
c = v.Aux.(ssa.PanicBoundsCC).Cy
|
||||
if c >= 0 && c <= abi.BoundsMaxConst {
|
||||
yVal = int(c)
|
||||
} else {
|
||||
// Move constant to a register
|
||||
yIsReg = true
|
||||
yVal = 1
|
||||
p := s.Prog(loong64.AMOVV)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = loong64.REG_R4 + int16(yVal)
|
||||
}
|
||||
}
|
||||
c := abi.BoundsEncode(code, signed, xIsReg, yIsReg, xVal, yVal)
|
||||
|
||||
p := s.Prog(obj.APCDATA)
|
||||
p.From.SetConst(abi.PCDATA_PanicBounds)
|
||||
p.To.SetConst(int64(c))
|
||||
p = s.Prog(obj.ACALL)
|
||||
p.To.Type = obj.TYPE_MEM
|
||||
p.To.Name = obj.NAME_EXTERN
|
||||
p.To.Sym = ssagen.BoundsCheckFunc[v.AuxInt]
|
||||
s.UseArgs(16) // space used in callee args area by assembly stubs
|
||||
p.To.Sym = ir.Syms.PanicBounds
|
||||
|
||||
case ssa.OpLOONG64LoweredAtomicLoad8, ssa.OpLOONG64LoweredAtomicLoad32, ssa.OpLOONG64LoweredAtomicLoad64:
|
||||
// MOVB (Rarg0), Rout
|
||||
// DBAR 0x14
|
||||
|
|
|
|||
|
|
@ -15,6 +15,7 @@ import (
|
|||
"cmd/compile/internal/types"
|
||||
"cmd/internal/obj"
|
||||
"cmd/internal/obj/mips"
|
||||
"internal/abi"
|
||||
)
|
||||
|
||||
// isFPreg reports whether r is an FP register.
|
||||
|
|
@ -486,18 +487,167 @@ func ssaGenValue(s *ssagen.State, v *ssa.Value) {
|
|||
p.To.Name = obj.NAME_EXTERN
|
||||
// AuxInt encodes how many buffer entries we need.
|
||||
p.To.Sym = ir.Syms.GCWriteBarrier[v.AuxInt-1]
|
||||
case ssa.OpMIPSLoweredPanicBoundsA, ssa.OpMIPSLoweredPanicBoundsB, ssa.OpMIPSLoweredPanicBoundsC:
|
||||
p := s.Prog(obj.ACALL)
|
||||
|
||||
case ssa.OpMIPSLoweredPanicBoundsRR, ssa.OpMIPSLoweredPanicBoundsRC, ssa.OpMIPSLoweredPanicBoundsCR, ssa.OpMIPSLoweredPanicBoundsCC,
|
||||
ssa.OpMIPSLoweredPanicExtendRR, ssa.OpMIPSLoweredPanicExtendRC:
|
||||
// Compute the constant we put in the PCData entry for this call.
|
||||
code, signed := ssa.BoundsKind(v.AuxInt).Code()
|
||||
xIsReg := false
|
||||
yIsReg := false
|
||||
xVal := 0
|
||||
yVal := 0
|
||||
extend := false
|
||||
switch v.Op {
|
||||
case ssa.OpMIPSLoweredPanicBoundsRR:
|
||||
xIsReg = true
|
||||
xVal = int(v.Args[0].Reg() - mips.REG_R1)
|
||||
yIsReg = true
|
||||
yVal = int(v.Args[1].Reg() - mips.REG_R1)
|
||||
case ssa.OpMIPSLoweredPanicExtendRR:
|
||||
extend = true
|
||||
xIsReg = true
|
||||
hi := int(v.Args[0].Reg() - mips.REG_R1)
|
||||
lo := int(v.Args[1].Reg() - mips.REG_R1)
|
||||
xVal = hi<<2 + lo // encode 2 register numbers
|
||||
yIsReg = true
|
||||
yVal = int(v.Args[2].Reg() - mips.REG_R1)
|
||||
case ssa.OpMIPSLoweredPanicBoundsRC:
|
||||
xIsReg = true
|
||||
xVal = int(v.Args[0].Reg() - mips.REG_R1)
|
||||
c := v.Aux.(ssa.PanicBoundsC).C
|
||||
if c >= 0 && c <= abi.BoundsMaxConst {
|
||||
yVal = int(c)
|
||||
} else {
|
||||
// Move constant to a register
|
||||
yIsReg = true
|
||||
if yVal == xVal {
|
||||
yVal = 1
|
||||
}
|
||||
p := s.Prog(mips.AMOVW)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = mips.REG_R1 + int16(yVal)
|
||||
}
|
||||
case ssa.OpMIPSLoweredPanicExtendRC:
|
||||
extend = true
|
||||
xIsReg = true
|
||||
hi := int(v.Args[0].Reg() - mips.REG_R1)
|
||||
lo := int(v.Args[1].Reg() - mips.REG_R1)
|
||||
xVal = hi<<2 + lo // encode 2 register numbers
|
||||
c := v.Aux.(ssa.PanicBoundsC).C
|
||||
if c >= 0 && c <= abi.BoundsMaxConst {
|
||||
yVal = int(c)
|
||||
} else {
|
||||
// Move constant to a register
|
||||
for yVal == hi || yVal == lo {
|
||||
yVal++
|
||||
}
|
||||
p := s.Prog(mips.AMOVW)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = mips.REG_R1 + int16(yVal)
|
||||
}
|
||||
case ssa.OpMIPSLoweredPanicBoundsCR:
|
||||
yIsReg = true
|
||||
yVal := int(v.Args[0].Reg() - mips.REG_R1)
|
||||
c := v.Aux.(ssa.PanicBoundsC).C
|
||||
if c >= 0 && c <= abi.BoundsMaxConst {
|
||||
xVal = int(c)
|
||||
} else if signed && int64(int32(c)) == c || !signed && int64(uint32(c)) == c {
|
||||
// Move constant to a register
|
||||
xIsReg = true
|
||||
if xVal == yVal {
|
||||
xVal = 1
|
||||
}
|
||||
p := s.Prog(mips.AMOVW)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = mips.REG_R1 + int16(xVal)
|
||||
} else {
|
||||
// Move constant to two registers
|
||||
extend = true
|
||||
xIsReg = true
|
||||
hi := 0
|
||||
lo := 1
|
||||
if hi == yVal {
|
||||
hi = 2
|
||||
}
|
||||
if lo == yVal {
|
||||
lo = 2
|
||||
}
|
||||
xVal = hi<<2 + lo
|
||||
p := s.Prog(mips.AMOVW)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c >> 32
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = mips.REG_R1 + int16(hi)
|
||||
p = s.Prog(mips.AMOVW)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = int64(int32(c))
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = mips.REG_R1 + int16(lo)
|
||||
}
|
||||
case ssa.OpMIPSLoweredPanicBoundsCC:
|
||||
c := v.Aux.(ssa.PanicBoundsCC).Cx
|
||||
if c >= 0 && c <= abi.BoundsMaxConst {
|
||||
xVal = int(c)
|
||||
} else if signed && int64(int32(c)) == c || !signed && int64(uint32(c)) == c {
|
||||
// Move constant to a register
|
||||
xIsReg = true
|
||||
p := s.Prog(mips.AMOVW)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = mips.REG_R1 + int16(xVal)
|
||||
} else {
|
||||
// Move constant to two registers
|
||||
extend = true
|
||||
xIsReg = true
|
||||
hi := 0
|
||||
lo := 1
|
||||
xVal = hi<<2 + lo
|
||||
p := s.Prog(mips.AMOVW)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c >> 32
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = mips.REG_R1 + int16(hi)
|
||||
p = s.Prog(mips.AMOVW)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = int64(int32(c))
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = mips.REG_R1 + int16(lo)
|
||||
}
|
||||
c = v.Aux.(ssa.PanicBoundsCC).Cy
|
||||
if c >= 0 && c <= abi.BoundsMaxConst {
|
||||
yVal = int(c)
|
||||
} else {
|
||||
// Move constant to a register
|
||||
yIsReg = true
|
||||
yVal = 2
|
||||
p := s.Prog(mips.AMOVW)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = mips.REG_R1 + int16(yVal)
|
||||
}
|
||||
}
|
||||
c := abi.BoundsEncode(code, signed, xIsReg, yIsReg, xVal, yVal)
|
||||
|
||||
p := s.Prog(obj.APCDATA)
|
||||
p.From.SetConst(abi.PCDATA_PanicBounds)
|
||||
p.To.SetConst(int64(c))
|
||||
p = s.Prog(obj.ACALL)
|
||||
p.To.Type = obj.TYPE_MEM
|
||||
p.To.Name = obj.NAME_EXTERN
|
||||
p.To.Sym = ssagen.BoundsCheckFunc[v.AuxInt]
|
||||
s.UseArgs(8) // space used in callee args area by assembly stubs
|
||||
case ssa.OpMIPSLoweredPanicExtendA, ssa.OpMIPSLoweredPanicExtendB, ssa.OpMIPSLoweredPanicExtendC:
|
||||
p := s.Prog(obj.ACALL)
|
||||
p.To.Type = obj.TYPE_MEM
|
||||
p.To.Name = obj.NAME_EXTERN
|
||||
p.To.Sym = ssagen.ExtendCheckFunc[v.AuxInt]
|
||||
s.UseArgs(12) // space used in callee args area by assembly stubs
|
||||
if extend {
|
||||
p.To.Sym = ir.Syms.PanicExtend
|
||||
} else {
|
||||
p.To.Sym = ir.Syms.PanicBounds
|
||||
}
|
||||
|
||||
case ssa.OpMIPSLoweredAtomicLoad8,
|
||||
ssa.OpMIPSLoweredAtomicLoad32:
|
||||
s.Prog(mips.ASYNC)
|
||||
|
|
|
|||
|
|
@ -15,6 +15,7 @@ import (
|
|||
"cmd/compile/internal/types"
|
||||
"cmd/internal/obj"
|
||||
"cmd/internal/obj/mips"
|
||||
"internal/abi"
|
||||
)
|
||||
|
||||
// isFPreg reports whether r is an FP register.
|
||||
|
|
@ -507,12 +508,93 @@ func ssaGenValue(s *ssagen.State, v *ssa.Value) {
|
|||
p.To.Name = obj.NAME_EXTERN
|
||||
// AuxInt encodes how many buffer entries we need.
|
||||
p.To.Sym = ir.Syms.GCWriteBarrier[v.AuxInt-1]
|
||||
case ssa.OpMIPS64LoweredPanicBoundsA, ssa.OpMIPS64LoweredPanicBoundsB, ssa.OpMIPS64LoweredPanicBoundsC:
|
||||
p := s.Prog(obj.ACALL)
|
||||
|
||||
case ssa.OpMIPS64LoweredPanicBoundsRR, ssa.OpMIPS64LoweredPanicBoundsRC, ssa.OpMIPS64LoweredPanicBoundsCR, ssa.OpMIPS64LoweredPanicBoundsCC:
|
||||
// Compute the constant we put in the PCData entry for this call.
|
||||
code, signed := ssa.BoundsKind(v.AuxInt).Code()
|
||||
xIsReg := false
|
||||
yIsReg := false
|
||||
xVal := 0
|
||||
yVal := 0
|
||||
switch v.Op {
|
||||
case ssa.OpMIPS64LoweredPanicBoundsRR:
|
||||
xIsReg = true
|
||||
xVal = int(v.Args[0].Reg() - mips.REG_R1)
|
||||
yIsReg = true
|
||||
yVal = int(v.Args[1].Reg() - mips.REG_R1)
|
||||
case ssa.OpMIPS64LoweredPanicBoundsRC:
|
||||
xIsReg = true
|
||||
xVal = int(v.Args[0].Reg() - mips.REG_R1)
|
||||
c := v.Aux.(ssa.PanicBoundsC).C
|
||||
if c >= 0 && c <= abi.BoundsMaxConst {
|
||||
yVal = int(c)
|
||||
} else {
|
||||
// Move constant to a register
|
||||
yIsReg = true
|
||||
if yVal == xVal {
|
||||
yVal = 1
|
||||
}
|
||||
p := s.Prog(mips.AMOVV)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = mips.REG_R1 + int16(yVal)
|
||||
}
|
||||
case ssa.OpMIPS64LoweredPanicBoundsCR:
|
||||
yIsReg = true
|
||||
yVal := int(v.Args[0].Reg() - mips.REG_R1)
|
||||
c := v.Aux.(ssa.PanicBoundsC).C
|
||||
if c >= 0 && c <= abi.BoundsMaxConst {
|
||||
xVal = int(c)
|
||||
} else {
|
||||
// Move constant to a register
|
||||
xIsReg = true
|
||||
if xVal == yVal {
|
||||
xVal = 1
|
||||
}
|
||||
p := s.Prog(mips.AMOVV)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = mips.REG_R1 + int16(xVal)
|
||||
}
|
||||
case ssa.OpMIPS64LoweredPanicBoundsCC:
|
||||
c := v.Aux.(ssa.PanicBoundsCC).Cx
|
||||
if c >= 0 && c <= abi.BoundsMaxConst {
|
||||
xVal = int(c)
|
||||
} else {
|
||||
// Move constant to a register
|
||||
xIsReg = true
|
||||
p := s.Prog(mips.AMOVV)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = mips.REG_R1 + int16(xVal)
|
||||
}
|
||||
c = v.Aux.(ssa.PanicBoundsCC).Cy
|
||||
if c >= 0 && c <= abi.BoundsMaxConst {
|
||||
yVal = int(c)
|
||||
} else {
|
||||
// Move constant to a register
|
||||
yIsReg = true
|
||||
yVal = 1
|
||||
p := s.Prog(mips.AMOVV)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = mips.REG_R1 + int16(yVal)
|
||||
}
|
||||
}
|
||||
c := abi.BoundsEncode(code, signed, xIsReg, yIsReg, xVal, yVal)
|
||||
|
||||
p := s.Prog(obj.APCDATA)
|
||||
p.From.SetConst(abi.PCDATA_PanicBounds)
|
||||
p.To.SetConst(int64(c))
|
||||
p = s.Prog(obj.ACALL)
|
||||
p.To.Type = obj.TYPE_MEM
|
||||
p.To.Name = obj.NAME_EXTERN
|
||||
p.To.Sym = ssagen.BoundsCheckFunc[v.AuxInt]
|
||||
s.UseArgs(16) // space used in callee args area by assembly stubs
|
||||
p.To.Sym = ir.Syms.PanicBounds
|
||||
|
||||
case ssa.OpMIPS64LoweredAtomicLoad8, ssa.OpMIPS64LoweredAtomicLoad32, ssa.OpMIPS64LoweredAtomicLoad64:
|
||||
as := mips.AMOVV
|
||||
switch v.Op {
|
||||
|
|
|
|||
|
|
@ -15,10 +15,10 @@ import (
|
|||
"internal/abi"
|
||||
)
|
||||
|
||||
// SwissMapGroupType makes the map slot group type given the type of the map.
|
||||
func SwissMapGroupType(t *types.Type) *types.Type {
|
||||
if t.MapType().SwissGroup != nil {
|
||||
return t.MapType().SwissGroup
|
||||
// MapGroupType makes the map slot group type given the type of the map.
|
||||
func MapGroupType(t *types.Type) *types.Type {
|
||||
if t.MapType().Group != nil {
|
||||
return t.MapType().Group
|
||||
}
|
||||
|
||||
// Builds a type representing a group structure for the given map type.
|
||||
|
|
@ -29,7 +29,7 @@ func SwissMapGroupType(t *types.Type) *types.Type {
|
|||
//
|
||||
// type group struct {
|
||||
// ctrl uint64
|
||||
// slots [abi.SwissMapGroupSlots]struct {
|
||||
// slots [abi.MapGroupSlots]struct {
|
||||
// key keyType
|
||||
// elem elemType
|
||||
// }
|
||||
|
|
@ -39,10 +39,10 @@ func SwissMapGroupType(t *types.Type) *types.Type {
|
|||
elemtype := t.Elem()
|
||||
types.CalcSize(keytype)
|
||||
types.CalcSize(elemtype)
|
||||
if keytype.Size() > abi.SwissMapMaxKeyBytes {
|
||||
if keytype.Size() > abi.MapMaxKeyBytes {
|
||||
keytype = types.NewPtr(keytype)
|
||||
}
|
||||
if elemtype.Size() > abi.SwissMapMaxElemBytes {
|
||||
if elemtype.Size() > abi.MapMaxElemBytes {
|
||||
elemtype = types.NewPtr(elemtype)
|
||||
}
|
||||
|
||||
|
|
@ -53,7 +53,7 @@ func SwissMapGroupType(t *types.Type) *types.Type {
|
|||
slot := types.NewStruct(slotFields)
|
||||
slot.SetNoalg(true)
|
||||
|
||||
slotArr := types.NewArray(slot, abi.SwissMapGroupSlots)
|
||||
slotArr := types.NewArray(slot, abi.MapGroupSlots)
|
||||
slotArr.SetNoalg(true)
|
||||
|
||||
fields := []*types.Field{
|
||||
|
|
@ -76,25 +76,25 @@ func SwissMapGroupType(t *types.Type) *types.Type {
|
|||
// the end to ensure pointers are valid.
|
||||
base.Fatalf("bad group size for %v", t)
|
||||
}
|
||||
if t.Key().Size() > abi.SwissMapMaxKeyBytes && !keytype.IsPtr() {
|
||||
if t.Key().Size() > abi.MapMaxKeyBytes && !keytype.IsPtr() {
|
||||
base.Fatalf("key indirect incorrect for %v", t)
|
||||
}
|
||||
if t.Elem().Size() > abi.SwissMapMaxElemBytes && !elemtype.IsPtr() {
|
||||
if t.Elem().Size() > abi.MapMaxElemBytes && !elemtype.IsPtr() {
|
||||
base.Fatalf("elem indirect incorrect for %v", t)
|
||||
}
|
||||
|
||||
t.MapType().SwissGroup = group
|
||||
t.MapType().Group = group
|
||||
group.StructType().Map = t
|
||||
return group
|
||||
}
|
||||
|
||||
var cachedSwissTableType *types.Type
|
||||
var cachedMapTableType *types.Type
|
||||
|
||||
// swissTableType returns a type interchangeable with internal/runtime/maps.table.
|
||||
// mapTableType returns a type interchangeable with internal/runtime/maps.table.
|
||||
// Make sure this stays in sync with internal/runtime/maps/table.go.
|
||||
func swissTableType() *types.Type {
|
||||
if cachedSwissTableType != nil {
|
||||
return cachedSwissTableType
|
||||
func mapTableType() *types.Type {
|
||||
if cachedMapTableType != nil {
|
||||
return cachedMapTableType
|
||||
}
|
||||
|
||||
// type table struct {
|
||||
|
|
@ -135,17 +135,17 @@ func swissTableType() *types.Type {
|
|||
base.Fatalf("internal/runtime/maps.table size not correct: got %d, want %d", table.Size(), size)
|
||||
}
|
||||
|
||||
cachedSwissTableType = table
|
||||
cachedMapTableType = table
|
||||
return table
|
||||
}
|
||||
|
||||
var cachedSwissMapType *types.Type
|
||||
var cachedMapType *types.Type
|
||||
|
||||
// SwissMapType returns a type interchangeable with internal/runtime/maps.Map.
|
||||
// MapType returns a type interchangeable with internal/runtime/maps.Map.
|
||||
// Make sure this stays in sync with internal/runtime/maps/map.go.
|
||||
func SwissMapType() *types.Type {
|
||||
if cachedSwissMapType != nil {
|
||||
return cachedSwissMapType
|
||||
func MapType() *types.Type {
|
||||
if cachedMapType != nil {
|
||||
return cachedMapType
|
||||
}
|
||||
|
||||
// type Map struct {
|
||||
|
|
@ -191,23 +191,23 @@ func SwissMapType() *types.Type {
|
|||
base.Fatalf("internal/runtime/maps.Map size not correct: got %d, want %d", m.Size(), size)
|
||||
}
|
||||
|
||||
cachedSwissMapType = m
|
||||
cachedMapType = m
|
||||
return m
|
||||
}
|
||||
|
||||
var cachedSwissIterType *types.Type
|
||||
var cachedMapIterType *types.Type
|
||||
|
||||
// SwissMapIterType returns a type interchangeable with runtime.hiter.
|
||||
// Make sure this stays in sync with runtime/map.go.
|
||||
func SwissMapIterType() *types.Type {
|
||||
if cachedSwissIterType != nil {
|
||||
return cachedSwissIterType
|
||||
// MapIterType returns a type interchangeable with internal/runtime/maps.Iter.
|
||||
// Make sure this stays in sync with internal/runtime/maps/table.go.
|
||||
func MapIterType() *types.Type {
|
||||
if cachedMapIterType != nil {
|
||||
return cachedMapIterType
|
||||
}
|
||||
|
||||
// type Iter struct {
|
||||
// key unsafe.Pointer // *Key
|
||||
// elem unsafe.Pointer // *Elem
|
||||
// typ unsafe.Pointer // *SwissMapType
|
||||
// typ unsafe.Pointer // *MapType
|
||||
// m *Map
|
||||
//
|
||||
// groupSlotOffset uint64
|
||||
|
|
@ -231,13 +231,13 @@ func SwissMapIterType() *types.Type {
|
|||
makefield("key", types.Types[types.TUNSAFEPTR]), // Used in range.go for TMAP.
|
||||
makefield("elem", types.Types[types.TUNSAFEPTR]), // Used in range.go for TMAP.
|
||||
makefield("typ", types.Types[types.TUNSAFEPTR]),
|
||||
makefield("m", types.NewPtr(SwissMapType())),
|
||||
makefield("m", types.NewPtr(MapType())),
|
||||
makefield("groupSlotOffset", types.Types[types.TUINT64]),
|
||||
makefield("dirOffset", types.Types[types.TUINT64]),
|
||||
makefield("clearSeq", types.Types[types.TUINT64]),
|
||||
makefield("globalDepth", types.Types[types.TUINT8]),
|
||||
makefield("dirIdx", types.Types[types.TINT]),
|
||||
makefield("tab", types.NewPtr(swissTableType())),
|
||||
makefield("tab", types.NewPtr(mapTableType())),
|
||||
makefield("group", types.Types[types.TUNSAFEPTR]),
|
||||
makefield("entryIdx", types.Types[types.TUINT64]),
|
||||
}
|
||||
|
|
@ -257,13 +257,13 @@ func SwissMapIterType() *types.Type {
|
|||
base.Fatalf("internal/runtime/maps.Iter size not correct: got %d, want %d", iter.Size(), size)
|
||||
}
|
||||
|
||||
cachedSwissIterType = iter
|
||||
cachedMapIterType = iter
|
||||
return iter
|
||||
}
|
||||
|
||||
func writeSwissMapType(t *types.Type, lsym *obj.LSym, c rttype.Cursor) {
|
||||
// internal/abi.SwissMapType
|
||||
gtyp := SwissMapGroupType(t)
|
||||
func writeMapType(t *types.Type, lsym *obj.LSym, c rttype.Cursor) {
|
||||
// internal/abi.MapType
|
||||
gtyp := MapGroupType(t)
|
||||
s1 := writeType(t.Key())
|
||||
s2 := writeType(t.Elem())
|
||||
s3 := writeType(gtyp)
|
||||
|
|
@ -287,16 +287,16 @@ func writeSwissMapType(t *types.Type, lsym *obj.LSym, c rttype.Cursor) {
|
|||
c.Field("ElemOff").WriteUintptr(uint64(elemOff))
|
||||
var flags uint32
|
||||
if needkeyupdate(t.Key()) {
|
||||
flags |= abi.SwissMapNeedKeyUpdate
|
||||
flags |= abi.MapNeedKeyUpdate
|
||||
}
|
||||
if hashMightPanic(t.Key()) {
|
||||
flags |= abi.SwissMapHashMightPanic
|
||||
flags |= abi.MapHashMightPanic
|
||||
}
|
||||
if t.Key().Size() > abi.SwissMapMaxKeyBytes {
|
||||
flags |= abi.SwissMapIndirectKey
|
||||
if t.Key().Size() > abi.MapMaxKeyBytes {
|
||||
flags |= abi.MapIndirectKey
|
||||
}
|
||||
if t.Elem().Size() > abi.SwissMapMaxKeyBytes {
|
||||
flags |= abi.SwissMapIndirectElem
|
||||
if t.Elem().Size() > abi.MapMaxKeyBytes {
|
||||
flags |= abi.MapIndirectElem
|
||||
}
|
||||
c.Field("Flags").WriteUint32(flags)
|
||||
|
||||
|
|
@ -1,305 +0,0 @@
|
|||
// Copyright 2024 The Go Authors. All rights reserved.
|
||||
// Use of this source code is governed by a BSD-style
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
package reflectdata
|
||||
|
||||
import (
|
||||
"internal/abi"
|
||||
|
||||
"cmd/compile/internal/base"
|
||||
"cmd/compile/internal/ir"
|
||||
"cmd/compile/internal/rttype"
|
||||
"cmd/compile/internal/types"
|
||||
"cmd/internal/obj"
|
||||
"cmd/internal/objabi"
|
||||
"cmd/internal/src"
|
||||
)
|
||||
|
||||
// OldMapBucketType makes the map bucket type given the type of the map.
|
||||
func OldMapBucketType(t *types.Type) *types.Type {
|
||||
// Builds a type representing a Bucket structure for
|
||||
// the given map type. This type is not visible to users -
|
||||
// we include only enough information to generate a correct GC
|
||||
// program for it.
|
||||
// Make sure this stays in sync with runtime/map.go.
|
||||
//
|
||||
// A "bucket" is a "struct" {
|
||||
// tophash [abi.OldMapBucketCount]uint8
|
||||
// keys [abi.OldMapBucketCount]keyType
|
||||
// elems [abi.OldMapBucketCount]elemType
|
||||
// overflow *bucket
|
||||
// }
|
||||
if t.MapType().OldBucket != nil {
|
||||
return t.MapType().OldBucket
|
||||
}
|
||||
|
||||
keytype := t.Key()
|
||||
elemtype := t.Elem()
|
||||
types.CalcSize(keytype)
|
||||
types.CalcSize(elemtype)
|
||||
if keytype.Size() > abi.OldMapMaxKeyBytes {
|
||||
keytype = types.NewPtr(keytype)
|
||||
}
|
||||
if elemtype.Size() > abi.OldMapMaxElemBytes {
|
||||
elemtype = types.NewPtr(elemtype)
|
||||
}
|
||||
|
||||
field := make([]*types.Field, 0, 5)
|
||||
|
||||
// The first field is: uint8 topbits[BUCKETSIZE].
|
||||
arr := types.NewArray(types.Types[types.TUINT8], abi.OldMapBucketCount)
|
||||
field = append(field, makefield("topbits", arr))
|
||||
|
||||
arr = types.NewArray(keytype, abi.OldMapBucketCount)
|
||||
arr.SetNoalg(true)
|
||||
keys := makefield("keys", arr)
|
||||
field = append(field, keys)
|
||||
|
||||
arr = types.NewArray(elemtype, abi.OldMapBucketCount)
|
||||
arr.SetNoalg(true)
|
||||
elems := makefield("elems", arr)
|
||||
field = append(field, elems)
|
||||
|
||||
// If keys and elems have no pointers, the map implementation
|
||||
// can keep a list of overflow pointers on the side so that
|
||||
// buckets can be marked as having no pointers.
|
||||
// Arrange for the bucket to have no pointers by changing
|
||||
// the type of the overflow field to uintptr in this case.
|
||||
// See comment on hmap.overflow in runtime/map.go.
|
||||
otyp := types.Types[types.TUNSAFEPTR]
|
||||
if !elemtype.HasPointers() && !keytype.HasPointers() {
|
||||
otyp = types.Types[types.TUINTPTR]
|
||||
}
|
||||
overflow := makefield("overflow", otyp)
|
||||
field = append(field, overflow)
|
||||
|
||||
// link up fields
|
||||
bucket := types.NewStruct(field[:])
|
||||
bucket.SetNoalg(true)
|
||||
types.CalcSize(bucket)
|
||||
|
||||
// Check invariants that map code depends on.
|
||||
if !types.IsComparable(t.Key()) {
|
||||
base.Fatalf("unsupported map key type for %v", t)
|
||||
}
|
||||
if abi.OldMapBucketCount < 8 {
|
||||
base.Fatalf("bucket size %d too small for proper alignment %d", abi.OldMapBucketCount, 8)
|
||||
}
|
||||
if uint8(keytype.Alignment()) > abi.OldMapBucketCount {
|
||||
base.Fatalf("key align too big for %v", t)
|
||||
}
|
||||
if uint8(elemtype.Alignment()) > abi.OldMapBucketCount {
|
||||
base.Fatalf("elem align %d too big for %v, BUCKETSIZE=%d", elemtype.Alignment(), t, abi.OldMapBucketCount)
|
||||
}
|
||||
if keytype.Size() > abi.OldMapMaxKeyBytes {
|
||||
base.Fatalf("key size too large for %v", t)
|
||||
}
|
||||
if elemtype.Size() > abi.OldMapMaxElemBytes {
|
||||
base.Fatalf("elem size too large for %v", t)
|
||||
}
|
||||
if t.Key().Size() > abi.OldMapMaxKeyBytes && !keytype.IsPtr() {
|
||||
base.Fatalf("key indirect incorrect for %v", t)
|
||||
}
|
||||
if t.Elem().Size() > abi.OldMapMaxElemBytes && !elemtype.IsPtr() {
|
||||
base.Fatalf("elem indirect incorrect for %v", t)
|
||||
}
|
||||
if keytype.Size()%keytype.Alignment() != 0 {
|
||||
base.Fatalf("key size not a multiple of key align for %v", t)
|
||||
}
|
||||
if elemtype.Size()%elemtype.Alignment() != 0 {
|
||||
base.Fatalf("elem size not a multiple of elem align for %v", t)
|
||||
}
|
||||
if uint8(bucket.Alignment())%uint8(keytype.Alignment()) != 0 {
|
||||
base.Fatalf("bucket align not multiple of key align %v", t)
|
||||
}
|
||||
if uint8(bucket.Alignment())%uint8(elemtype.Alignment()) != 0 {
|
||||
base.Fatalf("bucket align not multiple of elem align %v", t)
|
||||
}
|
||||
if keys.Offset%keytype.Alignment() != 0 {
|
||||
base.Fatalf("bad alignment of keys in bmap for %v", t)
|
||||
}
|
||||
if elems.Offset%elemtype.Alignment() != 0 {
|
||||
base.Fatalf("bad alignment of elems in bmap for %v", t)
|
||||
}
|
||||
|
||||
// Double-check that overflow field is final memory in struct,
|
||||
// with no padding at end.
|
||||
if overflow.Offset != bucket.Size()-int64(types.PtrSize) {
|
||||
base.Fatalf("bad offset of overflow in bmap for %v, overflow.Offset=%d, bucket.Size()-int64(types.PtrSize)=%d",
|
||||
t, overflow.Offset, bucket.Size()-int64(types.PtrSize))
|
||||
}
|
||||
|
||||
t.MapType().OldBucket = bucket
|
||||
|
||||
bucket.StructType().Map = t
|
||||
return bucket
|
||||
}
|
||||
|
||||
var oldHmapType *types.Type
|
||||
|
||||
// OldMapType returns a type interchangeable with runtime.hmap.
|
||||
// Make sure this stays in sync with runtime/map.go.
|
||||
func OldMapType() *types.Type {
|
||||
if oldHmapType != nil {
|
||||
return oldHmapType
|
||||
}
|
||||
|
||||
// build a struct:
|
||||
// type hmap struct {
|
||||
// count int
|
||||
// flags uint8
|
||||
// B uint8
|
||||
// noverflow uint16
|
||||
// hash0 uint32
|
||||
// buckets unsafe.Pointer
|
||||
// oldbuckets unsafe.Pointer
|
||||
// nevacuate uintptr
|
||||
// clearSeq uint64
|
||||
// extra unsafe.Pointer // *mapextra
|
||||
// }
|
||||
// must match runtime/map.go:hmap.
|
||||
fields := []*types.Field{
|
||||
makefield("count", types.Types[types.TINT]),
|
||||
makefield("flags", types.Types[types.TUINT8]),
|
||||
makefield("B", types.Types[types.TUINT8]),
|
||||
makefield("noverflow", types.Types[types.TUINT16]),
|
||||
makefield("hash0", types.Types[types.TUINT32]), // Used in walk.go for OMAKEMAP.
|
||||
makefield("buckets", types.Types[types.TUNSAFEPTR]), // Used in walk.go for OMAKEMAP.
|
||||
makefield("oldbuckets", types.Types[types.TUNSAFEPTR]),
|
||||
makefield("nevacuate", types.Types[types.TUINTPTR]),
|
||||
makefield("clearSeq", types.Types[types.TUINT64]),
|
||||
makefield("extra", types.Types[types.TUNSAFEPTR]),
|
||||
}
|
||||
|
||||
n := ir.NewDeclNameAt(src.NoXPos, ir.OTYPE, ir.Pkgs.Runtime.Lookup("hmap"))
|
||||
hmap := types.NewNamed(n)
|
||||
n.SetType(hmap)
|
||||
n.SetTypecheck(1)
|
||||
|
||||
hmap.SetUnderlying(types.NewStruct(fields))
|
||||
types.CalcSize(hmap)
|
||||
|
||||
// The size of hmap should be 56 bytes on 64 bit
|
||||
// and 36 bytes on 32 bit platforms.
|
||||
if size := int64(2*8 + 5*types.PtrSize); hmap.Size() != size {
|
||||
base.Fatalf("hmap size not correct: got %d, want %d", hmap.Size(), size)
|
||||
}
|
||||
|
||||
oldHmapType = hmap
|
||||
return hmap
|
||||
}
|
||||
|
||||
var oldHiterType *types.Type
|
||||
|
||||
// OldMapIterType returns a type interchangeable with runtime.hiter.
|
||||
// Make sure this stays in sync with runtime/map.go.
|
||||
func OldMapIterType() *types.Type {
|
||||
if oldHiterType != nil {
|
||||
return oldHiterType
|
||||
}
|
||||
|
||||
hmap := OldMapType()
|
||||
|
||||
// build a struct:
|
||||
// type hiter struct {
|
||||
// key unsafe.Pointer // *Key
|
||||
// elem unsafe.Pointer // *Elem
|
||||
// t unsafe.Pointer // *OldMapType
|
||||
// h *hmap
|
||||
// buckets unsafe.Pointer
|
||||
// bptr unsafe.Pointer // *bmap
|
||||
// overflow unsafe.Pointer // *[]*bmap
|
||||
// oldoverflow unsafe.Pointer // *[]*bmap
|
||||
// startBucket uintptr
|
||||
// offset uint8
|
||||
// wrapped bool
|
||||
// B uint8
|
||||
// i uint8
|
||||
// bucket uintptr
|
||||
// checkBucket uintptr
|
||||
// clearSeq uint64
|
||||
// }
|
||||
// must match runtime/map.go:hiter.
|
||||
fields := []*types.Field{
|
||||
makefield("key", types.Types[types.TUNSAFEPTR]), // Used in range.go for TMAP.
|
||||
makefield("elem", types.Types[types.TUNSAFEPTR]), // Used in range.go for TMAP.
|
||||
makefield("t", types.Types[types.TUNSAFEPTR]),
|
||||
makefield("h", types.NewPtr(hmap)),
|
||||
makefield("buckets", types.Types[types.TUNSAFEPTR]),
|
||||
makefield("bptr", types.Types[types.TUNSAFEPTR]),
|
||||
makefield("overflow", types.Types[types.TUNSAFEPTR]),
|
||||
makefield("oldoverflow", types.Types[types.TUNSAFEPTR]),
|
||||
makefield("startBucket", types.Types[types.TUINTPTR]),
|
||||
makefield("offset", types.Types[types.TUINT8]),
|
||||
makefield("wrapped", types.Types[types.TBOOL]),
|
||||
makefield("B", types.Types[types.TUINT8]),
|
||||
makefield("i", types.Types[types.TUINT8]),
|
||||
makefield("bucket", types.Types[types.TUINTPTR]),
|
||||
makefield("checkBucket", types.Types[types.TUINTPTR]),
|
||||
makefield("clearSeq", types.Types[types.TUINT64]),
|
||||
}
|
||||
|
||||
// build iterator struct holding the above fields
|
||||
n := ir.NewDeclNameAt(src.NoXPos, ir.OTYPE, ir.Pkgs.Runtime.Lookup("hiter"))
|
||||
hiter := types.NewNamed(n)
|
||||
n.SetType(hiter)
|
||||
n.SetTypecheck(1)
|
||||
|
||||
hiter.SetUnderlying(types.NewStruct(fields))
|
||||
types.CalcSize(hiter)
|
||||
if hiter.Size() != int64(8+12*types.PtrSize) {
|
||||
base.Fatalf("hash_iter size not correct %d %d", hiter.Size(), 8+12*types.PtrSize)
|
||||
}
|
||||
|
||||
oldHiterType = hiter
|
||||
return hiter
|
||||
}
|
||||
|
||||
func writeOldMapType(t *types.Type, lsym *obj.LSym, c rttype.Cursor) {
|
||||
// internal/abi.OldMapType
|
||||
s1 := writeType(t.Key())
|
||||
s2 := writeType(t.Elem())
|
||||
s3 := writeType(OldMapBucketType(t))
|
||||
hasher := genhash(t.Key())
|
||||
|
||||
c.Field("Key").WritePtr(s1)
|
||||
c.Field("Elem").WritePtr(s2)
|
||||
c.Field("Bucket").WritePtr(s3)
|
||||
c.Field("Hasher").WritePtr(hasher)
|
||||
var flags uint32
|
||||
// Note: flags must match maptype accessors in ../../../../runtime/type.go
|
||||
// and maptype builder in ../../../../reflect/type.go:MapOf.
|
||||
if t.Key().Size() > abi.OldMapMaxKeyBytes {
|
||||
c.Field("KeySize").WriteUint8(uint8(types.PtrSize))
|
||||
flags |= 1 // indirect key
|
||||
} else {
|
||||
c.Field("KeySize").WriteUint8(uint8(t.Key().Size()))
|
||||
}
|
||||
|
||||
if t.Elem().Size() > abi.OldMapMaxElemBytes {
|
||||
c.Field("ValueSize").WriteUint8(uint8(types.PtrSize))
|
||||
flags |= 2 // indirect value
|
||||
} else {
|
||||
c.Field("ValueSize").WriteUint8(uint8(t.Elem().Size()))
|
||||
}
|
||||
c.Field("BucketSize").WriteUint16(uint16(OldMapBucketType(t).Size()))
|
||||
if types.IsReflexive(t.Key()) {
|
||||
flags |= 4 // reflexive key
|
||||
}
|
||||
if needkeyupdate(t.Key()) {
|
||||
flags |= 8 // need key update
|
||||
}
|
||||
if hashMightPanic(t.Key()) {
|
||||
flags |= 16 // hash might panic
|
||||
}
|
||||
c.Field("Flags").WriteUint32(flags)
|
||||
|
||||
if u := t.Underlying(); u != t {
|
||||
// If t is a named map type, also keep the underlying map
|
||||
// type live in the binary. This is important to make sure that
|
||||
// a named map and that same map cast to its underlying type via
|
||||
// reflection, use the same hash function. See issue 37716.
|
||||
lsym.AddRel(base.Ctxt, obj.Reloc{Type: objabi.R_KEEP, Sym: writeType(u)})
|
||||
}
|
||||
}
|
||||
|
|
@ -8,7 +8,6 @@ import (
|
|||
"encoding/binary"
|
||||
"fmt"
|
||||
"internal/abi"
|
||||
"internal/buildcfg"
|
||||
"slices"
|
||||
"sort"
|
||||
"strings"
|
||||
|
|
@ -491,6 +490,9 @@ func dcommontype(c rttype.Cursor, t *types.Type) {
|
|||
exported = types.IsExported(t.Elem().Sym().Name)
|
||||
}
|
||||
}
|
||||
if types.IsDirectIface(t) {
|
||||
tflag |= abi.TFlagDirectIface
|
||||
}
|
||||
|
||||
if tflag != abi.TFlag(uint8(tflag)) {
|
||||
// this should optimize away completely
|
||||
|
|
@ -511,9 +513,6 @@ func dcommontype(c rttype.Cursor, t *types.Type) {
|
|||
c.Field("FieldAlign_").WriteUint8(uint8(t.Alignment()))
|
||||
|
||||
kind := kinds[t.Kind()]
|
||||
if types.IsDirectIface(t) {
|
||||
kind |= abi.KindDirectIface
|
||||
}
|
||||
c.Field("Kind_").WriteUint8(uint8(kind))
|
||||
|
||||
c.Field("Equal").WritePtr(eqfunc)
|
||||
|
|
@ -773,11 +772,7 @@ func writeType(t *types.Type) *obj.LSym {
|
|||
rt = rttype.InterfaceType
|
||||
dataAdd = len(imethods(t)) * int(rttype.IMethod.Size())
|
||||
case types.TMAP:
|
||||
if buildcfg.Experiment.SwissMap {
|
||||
rt = rttype.SwissMapType
|
||||
} else {
|
||||
rt = rttype.OldMapType
|
||||
}
|
||||
rt = rttype.MapType
|
||||
case types.TPTR:
|
||||
rt = rttype.PtrType
|
||||
// TODO: use rttype.Type for Elem() is ANY?
|
||||
|
|
@ -877,11 +872,7 @@ func writeType(t *types.Type) *obj.LSym {
|
|||
}
|
||||
|
||||
case types.TMAP:
|
||||
if buildcfg.Experiment.SwissMap {
|
||||
writeSwissMapType(t, lsym, c)
|
||||
} else {
|
||||
writeOldMapType(t, lsym, c)
|
||||
}
|
||||
writeMapType(t, lsym, c)
|
||||
|
||||
case types.TPTR:
|
||||
// internal/abi.PtrType
|
||||
|
|
|
|||
|
|
@ -14,6 +14,7 @@ import (
|
|||
"cmd/compile/internal/types"
|
||||
"cmd/internal/obj"
|
||||
"cmd/internal/obj/riscv"
|
||||
"internal/abi"
|
||||
)
|
||||
|
||||
// ssaRegToReg maps ssa register numbers to obj register numbers.
|
||||
|
|
@ -508,12 +509,91 @@ func ssaGenValue(s *ssagen.State, v *ssa.Value) {
|
|||
p.To.Name = obj.NAME_EXTERN
|
||||
// AuxInt encodes how many buffer entries we need.
|
||||
p.To.Sym = ir.Syms.GCWriteBarrier[v.AuxInt-1]
|
||||
case ssa.OpRISCV64LoweredPanicBoundsA, ssa.OpRISCV64LoweredPanicBoundsB, ssa.OpRISCV64LoweredPanicBoundsC:
|
||||
p := s.Prog(obj.ACALL)
|
||||
|
||||
case ssa.OpRISCV64LoweredPanicBoundsRR, ssa.OpRISCV64LoweredPanicBoundsRC, ssa.OpRISCV64LoweredPanicBoundsCR, ssa.OpRISCV64LoweredPanicBoundsCC:
|
||||
// Compute the constant we put in the PCData entry for this call.
|
||||
code, signed := ssa.BoundsKind(v.AuxInt).Code()
|
||||
xIsReg := false
|
||||
yIsReg := false
|
||||
xVal := 0
|
||||
yVal := 0
|
||||
switch v.Op {
|
||||
case ssa.OpRISCV64LoweredPanicBoundsRR:
|
||||
xIsReg = true
|
||||
xVal = int(v.Args[0].Reg() - riscv.REG_X5)
|
||||
yIsReg = true
|
||||
yVal = int(v.Args[1].Reg() - riscv.REG_X5)
|
||||
case ssa.OpRISCV64LoweredPanicBoundsRC:
|
||||
xIsReg = true
|
||||
xVal = int(v.Args[0].Reg() - riscv.REG_X5)
|
||||
c := v.Aux.(ssa.PanicBoundsC).C
|
||||
if c >= 0 && c <= abi.BoundsMaxConst {
|
||||
yVal = int(c)
|
||||
} else {
|
||||
// Move constant to a register
|
||||
yIsReg = true
|
||||
if yVal == xVal {
|
||||
yVal = 1
|
||||
}
|
||||
p := s.Prog(riscv.AMOV)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = riscv.REG_X5 + int16(yVal)
|
||||
}
|
||||
case ssa.OpRISCV64LoweredPanicBoundsCR:
|
||||
yIsReg = true
|
||||
yVal := int(v.Args[0].Reg() - riscv.REG_X5)
|
||||
c := v.Aux.(ssa.PanicBoundsC).C
|
||||
if c >= 0 && c <= abi.BoundsMaxConst {
|
||||
xVal = int(c)
|
||||
} else {
|
||||
// Move constant to a register
|
||||
if xVal == yVal {
|
||||
xVal = 1
|
||||
}
|
||||
p := s.Prog(riscv.AMOV)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = riscv.REG_X5 + int16(xVal)
|
||||
}
|
||||
case ssa.OpRISCV64LoweredPanicBoundsCC:
|
||||
c := v.Aux.(ssa.PanicBoundsCC).Cx
|
||||
if c >= 0 && c <= abi.BoundsMaxConst {
|
||||
xVal = int(c)
|
||||
} else {
|
||||
// Move constant to a register
|
||||
xIsReg = true
|
||||
p := s.Prog(riscv.AMOV)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = riscv.REG_X5 + int16(xVal)
|
||||
}
|
||||
c = v.Aux.(ssa.PanicBoundsCC).Cy
|
||||
if c >= 0 && c <= abi.BoundsMaxConst {
|
||||
yVal = int(c)
|
||||
} else {
|
||||
// Move constant to a register
|
||||
yIsReg = true
|
||||
yVal = 1
|
||||
p := s.Prog(riscv.AMOV)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = riscv.REG_X5 + int16(yVal)
|
||||
}
|
||||
}
|
||||
c := abi.BoundsEncode(code, signed, xIsReg, yIsReg, xVal, yVal)
|
||||
|
||||
p := s.Prog(obj.APCDATA)
|
||||
p.From.SetConst(abi.PCDATA_PanicBounds)
|
||||
p.To.SetConst(int64(c))
|
||||
p = s.Prog(obj.ACALL)
|
||||
p.To.Type = obj.TYPE_MEM
|
||||
p.To.Name = obj.NAME_EXTERN
|
||||
p.To.Sym = ssagen.BoundsCheckFunc[v.AuxInt]
|
||||
s.UseArgs(16) // space used in callee args area by assembly stubs
|
||||
p.To.Sym = ir.Syms.PanicBounds
|
||||
|
||||
case ssa.OpRISCV64LoweredAtomicLoad8:
|
||||
s.Prog(riscv.AFENCE)
|
||||
|
|
|
|||
|
|
@ -27,8 +27,7 @@ var ArrayType *types.Type
|
|||
var ChanType *types.Type
|
||||
var FuncType *types.Type
|
||||
var InterfaceType *types.Type
|
||||
var OldMapType *types.Type
|
||||
var SwissMapType *types.Type
|
||||
var MapType *types.Type
|
||||
var PtrType *types.Type
|
||||
var SliceType *types.Type
|
||||
var StructType *types.Type
|
||||
|
|
@ -55,8 +54,7 @@ func Init() {
|
|||
ChanType = FromReflect(reflect.TypeOf(abi.ChanType{}))
|
||||
FuncType = FromReflect(reflect.TypeOf(abi.FuncType{}))
|
||||
InterfaceType = FromReflect(reflect.TypeOf(abi.InterfaceType{}))
|
||||
OldMapType = FromReflect(reflect.TypeOf(abi.OldMapType{}))
|
||||
SwissMapType = FromReflect(reflect.TypeOf(abi.SwissMapType{}))
|
||||
MapType = FromReflect(reflect.TypeOf(abi.MapType{}))
|
||||
PtrType = FromReflect(reflect.TypeOf(abi.PtrType{}))
|
||||
SliceType = FromReflect(reflect.TypeOf(abi.SliceType{}))
|
||||
StructType = FromReflect(reflect.TypeOf(abi.StructType{}))
|
||||
|
|
|
|||
|
|
@ -15,6 +15,7 @@ import (
|
|||
"cmd/compile/internal/types"
|
||||
"cmd/internal/obj"
|
||||
"cmd/internal/obj/s390x"
|
||||
"internal/abi"
|
||||
)
|
||||
|
||||
// ssaMarkMoves marks any MOVXconst ops that need to avoid clobbering flags.
|
||||
|
|
@ -281,6 +282,10 @@ func ssaGenValue(s *ssagen.State, v *ssa.Value) {
|
|||
case ssa.OpS390XCPSDR:
|
||||
p := opregreg(s, v.Op.Asm(), v.Reg(), v.Args[1].Reg())
|
||||
p.Reg = v.Args[0].Reg()
|
||||
case ssa.OpS390XWFMAXDB, ssa.OpS390XWFMAXSB,
|
||||
ssa.OpS390XWFMINDB, ssa.OpS390XWFMINSB:
|
||||
p := opregregimm(s, v.Op.Asm(), v.Reg(), v.Args[0].Reg(), 1 /* Java Math.Max() */)
|
||||
p.AddRestSource(obj.Addr{Type: obj.TYPE_REG, Reg: v.Args[1].Reg()})
|
||||
case ssa.OpS390XDIVD, ssa.OpS390XDIVW,
|
||||
ssa.OpS390XDIVDU, ssa.OpS390XDIVWU,
|
||||
ssa.OpS390XMODD, ssa.OpS390XMODW,
|
||||
|
|
@ -569,12 +574,92 @@ func ssaGenValue(s *ssagen.State, v *ssa.Value) {
|
|||
p.To.Name = obj.NAME_EXTERN
|
||||
// AuxInt encodes how many buffer entries we need.
|
||||
p.To.Sym = ir.Syms.GCWriteBarrier[v.AuxInt-1]
|
||||
case ssa.OpS390XLoweredPanicBoundsA, ssa.OpS390XLoweredPanicBoundsB, ssa.OpS390XLoweredPanicBoundsC:
|
||||
p := s.Prog(obj.ACALL)
|
||||
|
||||
case ssa.OpS390XLoweredPanicBoundsRR, ssa.OpS390XLoweredPanicBoundsRC, ssa.OpS390XLoweredPanicBoundsCR, ssa.OpS390XLoweredPanicBoundsCC:
|
||||
// Compute the constant we put in the PCData entry for this call.
|
||||
code, signed := ssa.BoundsKind(v.AuxInt).Code()
|
||||
xIsReg := false
|
||||
yIsReg := false
|
||||
xVal := 0
|
||||
yVal := 0
|
||||
switch v.Op {
|
||||
case ssa.OpS390XLoweredPanicBoundsRR:
|
||||
xIsReg = true
|
||||
xVal = int(v.Args[0].Reg() - s390x.REG_R0)
|
||||
yIsReg = true
|
||||
yVal = int(v.Args[1].Reg() - s390x.REG_R0)
|
||||
case ssa.OpS390XLoweredPanicBoundsRC:
|
||||
xIsReg = true
|
||||
xVal = int(v.Args[0].Reg() - s390x.REG_R0)
|
||||
c := v.Aux.(ssa.PanicBoundsC).C
|
||||
if c >= 0 && c <= abi.BoundsMaxConst {
|
||||
yVal = int(c)
|
||||
} else {
|
||||
// Move constant to a register
|
||||
yIsReg = true
|
||||
if yVal == xVal {
|
||||
yVal = 1
|
||||
}
|
||||
p := s.Prog(s390x.AMOVD)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = s390x.REG_R0 + int16(yVal)
|
||||
}
|
||||
case ssa.OpS390XLoweredPanicBoundsCR:
|
||||
yIsReg = true
|
||||
yVal := int(v.Args[0].Reg() - s390x.REG_R0)
|
||||
c := v.Aux.(ssa.PanicBoundsC).C
|
||||
if c >= 0 && c <= abi.BoundsMaxConst {
|
||||
xVal = int(c)
|
||||
} else {
|
||||
// Move constant to a register
|
||||
if xVal == yVal {
|
||||
xVal = 1
|
||||
}
|
||||
p := s.Prog(s390x.AMOVD)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = s390x.REG_R0 + int16(xVal)
|
||||
}
|
||||
case ssa.OpS390XLoweredPanicBoundsCC:
|
||||
c := v.Aux.(ssa.PanicBoundsCC).Cx
|
||||
if c >= 0 && c <= abi.BoundsMaxConst {
|
||||
xVal = int(c)
|
||||
} else {
|
||||
// Move constant to a register
|
||||
xIsReg = true
|
||||
p := s.Prog(s390x.AMOVD)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = s390x.REG_R0 + int16(xVal)
|
||||
}
|
||||
c = v.Aux.(ssa.PanicBoundsCC).Cy
|
||||
if c >= 0 && c <= abi.BoundsMaxConst {
|
||||
yVal = int(c)
|
||||
} else {
|
||||
// Move constant to a register
|
||||
yIsReg = true
|
||||
yVal = 1
|
||||
p := s.Prog(s390x.AMOVD)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = c
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = s390x.REG_R0 + int16(yVal)
|
||||
}
|
||||
}
|
||||
c := abi.BoundsEncode(code, signed, xIsReg, yIsReg, xVal, yVal)
|
||||
|
||||
p := s.Prog(obj.APCDATA)
|
||||
p.From.SetConst(abi.PCDATA_PanicBounds)
|
||||
p.To.SetConst(int64(c))
|
||||
p = s.Prog(obj.ACALL)
|
||||
p.To.Type = obj.TYPE_MEM
|
||||
p.To.Name = obj.NAME_EXTERN
|
||||
p.To.Sym = ssagen.BoundsCheckFunc[v.AuxInt]
|
||||
s.UseArgs(16) // space used in callee args area by assembly stubs
|
||||
p.To.Sym = ir.Syms.PanicBounds
|
||||
|
||||
case ssa.OpS390XFLOGR, ssa.OpS390XPOPCNT,
|
||||
ssa.OpS390XNEG, ssa.OpS390XNEGW,
|
||||
ssa.OpS390XMOVWBR, ssa.OpS390XMOVDBR:
|
||||
|
|
|
|||
|
|
@ -363,13 +363,16 @@
|
|||
// Write barrier.
|
||||
(WB ...) => (LoweredWB ...)
|
||||
|
||||
(PanicBounds [kind] x y mem) && boundsABI(kind) == 0 => (LoweredPanicBoundsA [kind] x y mem)
|
||||
(PanicBounds [kind] x y mem) && boundsABI(kind) == 1 => (LoweredPanicBoundsB [kind] x y mem)
|
||||
(PanicBounds [kind] x y mem) && boundsABI(kind) == 2 => (LoweredPanicBoundsC [kind] x y mem)
|
||||
(PanicBounds ...) => (LoweredPanicBoundsRR ...)
|
||||
(PanicExtend ...) => (LoweredPanicExtendRR ...)
|
||||
|
||||
(PanicExtend [kind] hi lo y mem) && boundsABI(kind) == 0 => (LoweredPanicExtendA [kind] hi lo y mem)
|
||||
(PanicExtend [kind] hi lo y mem) && boundsABI(kind) == 1 => (LoweredPanicExtendB [kind] hi lo y mem)
|
||||
(PanicExtend [kind] hi lo y mem) && boundsABI(kind) == 2 => (LoweredPanicExtendC [kind] hi lo y mem)
|
||||
(LoweredPanicBoundsRR [kind] x (MOVLconst [c]) mem) => (LoweredPanicBoundsRC [kind] x {PanicBoundsC{C:int64(c)}} mem)
|
||||
(LoweredPanicBoundsRR [kind] (MOVLconst [c]) y mem) => (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:int64(c)}} y mem)
|
||||
(LoweredPanicBoundsRC [kind] {p} (MOVLconst [c]) mem) => (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:int64(c), Cy:p.C}} mem)
|
||||
|
||||
(LoweredPanicExtendRR [kind] hi lo (MOVLconst [c]) mem) => (LoweredPanicExtendRC [kind] hi lo {PanicBoundsC{C:int64(c)}} mem)
|
||||
(LoweredPanicExtendRR [kind] (MOVLconst [hi]) (MOVLconst [lo]) y mem) => (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:int64(hi)<<32 + int64(uint32(lo))}} y mem)
|
||||
(LoweredPanicExtendRC [kind] {p} (MOVLconst [hi]) (MOVLconst [lo]) mem) => (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:int64(hi)<<32+int64(uint32(lo)), Cy:p.C}} mem)
|
||||
|
||||
// ***************************
|
||||
// Above: lowering rules
|
||||
|
|
|
|||
|
|
@ -76,7 +76,6 @@ func init() {
|
|||
cx = buildReg("CX")
|
||||
dx = buildReg("DX")
|
||||
bx = buildReg("BX")
|
||||
si = buildReg("SI")
|
||||
gp = buildReg("AX CX DX BX BP SI DI")
|
||||
fp = buildReg("X0 X1 X2 X3 X4 X5 X6 X7")
|
||||
gpsp = gp | buildReg("SP")
|
||||
|
|
@ -523,16 +522,19 @@ func init() {
|
|||
// Returns a pointer to a write barrier buffer in DI.
|
||||
{name: "LoweredWB", argLength: 1, reg: regInfo{clobbers: callerSave &^ gp, outputs: []regMask{buildReg("DI")}}, clobberFlags: true, aux: "Int64"},
|
||||
|
||||
// There are three of these functions so that they can have three different register inputs.
|
||||
// When we check 0 <= c <= cap (A), then 0 <= b <= c (B), then 0 <= a <= b (C), we want the
|
||||
// default registers to match so we don't need to copy registers around unnecessarily.
|
||||
{name: "LoweredPanicBoundsA", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{dx, bx}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in genericOps.go).
|
||||
{name: "LoweredPanicBoundsB", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{cx, dx}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in genericOps.go).
|
||||
{name: "LoweredPanicBoundsC", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{ax, cx}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in genericOps.go).
|
||||
// Extend ops are the same as Bounds ops except the indexes are 64-bit.
|
||||
{name: "LoweredPanicExtendA", argLength: 4, aux: "Int64", reg: regInfo{inputs: []regMask{si, dx, bx}}, typ: "Mem", call: true}, // arg0=idxHi, arg1=idxLo, arg2=len, arg3=mem, returns memory. AuxInt contains report code (see PanicExtend in genericOps.go).
|
||||
{name: "LoweredPanicExtendB", argLength: 4, aux: "Int64", reg: regInfo{inputs: []regMask{si, cx, dx}}, typ: "Mem", call: true}, // arg0=idxHi, arg1=idxLo, arg2=len, arg3=mem, returns memory. AuxInt contains report code (see PanicExtend in genericOps.go).
|
||||
{name: "LoweredPanicExtendC", argLength: 4, aux: "Int64", reg: regInfo{inputs: []regMask{si, ax, cx}}, typ: "Mem", call: true}, // arg0=idxHi, arg1=idxLo, arg2=len, arg3=mem, returns memory. AuxInt contains report code (see PanicExtend in genericOps.go).
|
||||
// LoweredPanicBoundsRR takes x and y, two values that caused a bounds check to fail.
|
||||
// the RC and CR versions are used when one of the arguments is a constant. CC is used
|
||||
// when both are constant (normally both 0, as prove derives the fact that a [0] bounds
|
||||
// failure means the length must have also been 0).
|
||||
// AuxInt contains a report code (see PanicBounds in genericOps.go).
|
||||
{name: "LoweredPanicBoundsRR", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{gp, gp}}, typ: "Mem", call: true}, // arg0=x, arg1=y, arg2=mem, returns memory.
|
||||
{name: "LoweredPanicBoundsRC", argLength: 2, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{gp}}, typ: "Mem", call: true}, // arg0=x, arg1=mem, returns memory.
|
||||
{name: "LoweredPanicBoundsCR", argLength: 2, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{gp}}, typ: "Mem", call: true}, // arg0=y, arg1=mem, returns memory.
|
||||
{name: "LoweredPanicBoundsCC", argLength: 1, aux: "PanicBoundsCC", reg: regInfo{}, typ: "Mem", call: true}, // arg0=mem, returns memory.
|
||||
|
||||
// Same as above, but the x value is 64 bits.
|
||||
{name: "LoweredPanicExtendRR", argLength: 4, aux: "Int64", reg: regInfo{inputs: []regMask{ax | cx | dx | bx, ax | cx | dx | bx, gp}}, typ: "Mem", call: true}, // arg0=x_hi, arg1=x_lo, arg2=y, arg3=mem, returns memory.
|
||||
{name: "LoweredPanicExtendRC", argLength: 3, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{ax | cx | dx | bx, ax | cx | dx | bx}}, typ: "Mem", call: true}, // arg0=x_hi, arg1=x_lo, arg2=mem, returns memory.
|
||||
|
||||
// Constant flag values. For any comparison, there are 5 possible
|
||||
// outcomes: the three from the signed total order (<,==,>) and the
|
||||
|
|
|
|||
|
|
@ -375,34 +375,17 @@
|
|||
(MOVQstoreconst [makeValAndOff(0,int32(s-8))] destptr
|
||||
(MOVQstoreconst [makeValAndOff(0,0)] destptr mem))
|
||||
|
||||
// Adjust zeros to be a multiple of 16 bytes.
|
||||
(Zero [s] destptr mem) && s%16 != 0 && s > 16 =>
|
||||
(Zero [s-s%16] (OffPtr <destptr.Type> destptr [s%16])
|
||||
(MOVOstoreconst [makeValAndOff(0,0)] destptr mem))
|
||||
// Zeroing up to 192 bytes uses straightline code.
|
||||
(Zero [s] destptr mem) && s >= 16 && s < 192 => (LoweredZero [s] destptr mem)
|
||||
|
||||
(Zero [16] destptr mem) =>
|
||||
(MOVOstoreconst [makeValAndOff(0,0)] destptr mem)
|
||||
(Zero [32] destptr mem) =>
|
||||
(MOVOstoreconst [makeValAndOff(0,16)] destptr
|
||||
(MOVOstoreconst [makeValAndOff(0,0)] destptr mem))
|
||||
(Zero [48] destptr mem) =>
|
||||
(MOVOstoreconst [makeValAndOff(0,32)] destptr
|
||||
(MOVOstoreconst [makeValAndOff(0,16)] destptr
|
||||
(MOVOstoreconst [makeValAndOff(0,0)] destptr mem)))
|
||||
(Zero [64] destptr mem) =>
|
||||
(MOVOstoreconst [makeValAndOff(0,48)] destptr
|
||||
(MOVOstoreconst [makeValAndOff(0,32)] destptr
|
||||
(MOVOstoreconst [makeValAndOff(0,16)] destptr
|
||||
(MOVOstoreconst [makeValAndOff(0,0)] destptr mem))))
|
||||
|
||||
// Medium zeroing uses a duff device.
|
||||
(Zero [s] destptr mem)
|
||||
&& s > 64 && s <= 1024 && s%16 == 0 =>
|
||||
(DUFFZERO [s] destptr mem)
|
||||
// Zeroing up to ~1KB uses a small loop.
|
||||
(Zero [s] destptr mem) && s >= 192 && s <= repZeroThreshold => (LoweredZeroLoop [s] destptr mem)
|
||||
|
||||
// Large zeroing uses REP STOSQ.
|
||||
(Zero [s] destptr mem)
|
||||
&& s > 1024 && s%8 == 0 =>
|
||||
(Zero [s] destptr mem) && s > repZeroThreshold && s%8 != 0 =>
|
||||
(Zero [s-s%8] (OffPtr <destptr.Type> destptr [s%8])
|
||||
(MOVOstoreconst [makeValAndOff(0,0)] destptr mem))
|
||||
(Zero [s] destptr mem) && s > repZeroThreshold && s%8 == 0 =>
|
||||
(REPSTOSQ destptr (MOVQconst [s/8]) (MOVQconst [0]) mem)
|
||||
|
||||
// Lowering constants
|
||||
|
|
@ -558,9 +541,11 @@
|
|||
// Write barrier.
|
||||
(WB ...) => (LoweredWB ...)
|
||||
|
||||
(PanicBounds [kind] x y mem) && boundsABI(kind) == 0 => (LoweredPanicBoundsA [kind] x y mem)
|
||||
(PanicBounds [kind] x y mem) && boundsABI(kind) == 1 => (LoweredPanicBoundsB [kind] x y mem)
|
||||
(PanicBounds [kind] x y mem) && boundsABI(kind) == 2 => (LoweredPanicBoundsC [kind] x y mem)
|
||||
(PanicBounds ...) => (LoweredPanicBoundsRR ...)
|
||||
(LoweredPanicBoundsRR [kind] x (MOVQconst [c]) mem) => (LoweredPanicBoundsRC [kind] x {PanicBoundsC{C:c}} mem)
|
||||
(LoweredPanicBoundsRR [kind] (MOVQconst [c]) y mem) => (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:c}} y mem)
|
||||
(LoweredPanicBoundsRC [kind] {p} (MOVQconst [c]) mem) => (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:c, Cy:p.C}} mem)
|
||||
(LoweredPanicBoundsCR [kind] {p} (MOVQconst [c]) mem) => (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:p.C, Cy:c}} mem)
|
||||
|
||||
// lowering rotates
|
||||
(RotateLeft8 ...) => (ROLB ...)
|
||||
|
|
|
|||
|
|
@ -121,7 +121,6 @@ func init() {
|
|||
ax = buildReg("AX")
|
||||
cx = buildReg("CX")
|
||||
dx = buildReg("DX")
|
||||
bx = buildReg("BX")
|
||||
gp = buildReg("AX CX DX BX BP SI DI R8 R9 R10 R11 R12 R13 R15")
|
||||
g = buildReg("g")
|
||||
fp = buildReg("X0 X1 X2 X3 X4 X5 X6 X7 X8 X9 X10 X11 X12 X13 X14")
|
||||
|
|
@ -964,15 +963,30 @@ func init() {
|
|||
// auxint = # of bytes to zero
|
||||
// returns mem
|
||||
{
|
||||
name: "DUFFZERO",
|
||||
name: "LoweredZero",
|
||||
aux: "Int64",
|
||||
argLength: 2,
|
||||
reg: regInfo{
|
||||
inputs: []regMask{buildReg("DI")},
|
||||
clobbers: buildReg("DI"),
|
||||
inputs: []regMask{gp},
|
||||
},
|
||||
//faultOnNilArg0: true, // Note: removed for 73748. TODO: reenable at some point
|
||||
unsafePoint: true, // FP maintenance around DUFFCOPY can be clobbered by interrupts
|
||||
faultOnNilArg0: true,
|
||||
},
|
||||
|
||||
// arg0 = pointer to start of memory to zero
|
||||
// arg1 = mem
|
||||
// auxint = # of bytes to zero
|
||||
// returns mem
|
||||
{
|
||||
name: "LoweredZeroLoop",
|
||||
aux: "Int64",
|
||||
argLength: 2,
|
||||
reg: regInfo{
|
||||
inputs: []regMask{gp},
|
||||
clobbersArg0: true,
|
||||
},
|
||||
clobberFlags: true,
|
||||
faultOnNilArg0: true,
|
||||
needIntTemp: true,
|
||||
},
|
||||
|
||||
// arg0 = address of memory to zero
|
||||
|
|
@ -1060,12 +1074,15 @@ func init() {
|
|||
|
||||
{name: "LoweredHasCPUFeature", argLength: 0, reg: gp01, rematerializeable: true, typ: "UInt64", aux: "Sym", symEffect: "None"},
|
||||
|
||||
// There are three of these functions so that they can have three different register inputs.
|
||||
// When we check 0 <= c <= cap (A), then 0 <= b <= c (B), then 0 <= a <= b (C), we want the
|
||||
// default registers to match so we don't need to copy registers around unnecessarily.
|
||||
{name: "LoweredPanicBoundsA", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{dx, bx}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in generic.go).
|
||||
{name: "LoweredPanicBoundsB", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{cx, dx}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in generic.go).
|
||||
{name: "LoweredPanicBoundsC", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{ax, cx}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in generic.go).
|
||||
// LoweredPanicBoundsRR takes x and y, two values that caused a bounds check to fail.
|
||||
// the RC and CR versions are used when one of the arguments is a constant. CC is used
|
||||
// when both are constant (normally both 0, as prove derives the fact that a [0] bounds
|
||||
// failure means the length must have also been 0).
|
||||
// AuxInt contains a report code (see PanicBounds in genericOps.go).
|
||||
{name: "LoweredPanicBoundsRR", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{gp, gp}}, typ: "Mem", call: true}, // arg0=x, arg1=y, arg2=mem, returns memory.
|
||||
{name: "LoweredPanicBoundsRC", argLength: 2, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{gp}}, typ: "Mem", call: true}, // arg0=x, arg1=mem, returns memory.
|
||||
{name: "LoweredPanicBoundsCR", argLength: 2, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{gp}}, typ: "Mem", call: true}, // arg0=y, arg1=mem, returns memory.
|
||||
{name: "LoweredPanicBoundsCC", argLength: 1, aux: "PanicBoundsCC", reg: regInfo{}, typ: "Mem", call: true}, // arg0=mem, returns memory.
|
||||
|
||||
// Constant flag values. For any comparison, there are 5 possible
|
||||
// outcomes: the three from the signed total order (<,==,>) and the
|
||||
|
|
|
|||
|
|
@ -395,13 +395,16 @@
|
|||
// Write barrier.
|
||||
(WB ...) => (LoweredWB ...)
|
||||
|
||||
(PanicBounds [kind] x y mem) && boundsABI(kind) == 0 => (LoweredPanicBoundsA [kind] x y mem)
|
||||
(PanicBounds [kind] x y mem) && boundsABI(kind) == 1 => (LoweredPanicBoundsB [kind] x y mem)
|
||||
(PanicBounds [kind] x y mem) && boundsABI(kind) == 2 => (LoweredPanicBoundsC [kind] x y mem)
|
||||
(PanicBounds ...) => (LoweredPanicBoundsRR ...)
|
||||
(PanicExtend ...) => (LoweredPanicExtendRR ...)
|
||||
|
||||
(PanicExtend [kind] hi lo y mem) && boundsABI(kind) == 0 => (LoweredPanicExtendA [kind] hi lo y mem)
|
||||
(PanicExtend [kind] hi lo y mem) && boundsABI(kind) == 1 => (LoweredPanicExtendB [kind] hi lo y mem)
|
||||
(PanicExtend [kind] hi lo y mem) && boundsABI(kind) == 2 => (LoweredPanicExtendC [kind] hi lo y mem)
|
||||
(LoweredPanicBoundsRR [kind] x (MOVWconst [c]) mem) => (LoweredPanicBoundsRC [kind] x {PanicBoundsC{C:int64(c)}} mem)
|
||||
(LoweredPanicBoundsRR [kind] (MOVWconst [c]) y mem) => (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:int64(c)}} y mem)
|
||||
(LoweredPanicBoundsRC [kind] {p} (MOVWconst [c]) mem) => (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:int64(c), Cy:p.C}} mem)
|
||||
|
||||
(LoweredPanicExtendRR [kind] hi lo (MOVWconst [c]) mem) => (LoweredPanicExtendRC [kind] hi lo {PanicBoundsC{C:int64(c)}} mem)
|
||||
(LoweredPanicExtendRR [kind] (MOVWconst [hi]) (MOVWconst [lo]) y mem) => (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:int64(hi)<<32 + int64(uint32(lo))}} y mem)
|
||||
(LoweredPanicExtendRC [kind] {p} (MOVWconst [hi]) (MOVWconst [lo]) mem) => (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:int64(hi)<<32+int64(uint32(lo)), Cy:p.C}} mem)
|
||||
|
||||
// Optimizations
|
||||
|
||||
|
|
|
|||
|
|
@ -601,9 +601,11 @@
|
|||
// Publication barrier (0xe is ST option)
|
||||
(PubBarrier mem) => (DMB [0xe] mem)
|
||||
|
||||
(PanicBounds [kind] x y mem) && boundsABI(kind) == 0 => (LoweredPanicBoundsA [kind] x y mem)
|
||||
(PanicBounds [kind] x y mem) && boundsABI(kind) == 1 => (LoweredPanicBoundsB [kind] x y mem)
|
||||
(PanicBounds [kind] x y mem) && boundsABI(kind) == 2 => (LoweredPanicBoundsC [kind] x y mem)
|
||||
(PanicBounds ...) => (LoweredPanicBoundsRR ...)
|
||||
(LoweredPanicBoundsRR [kind] x (MOVDconst [c]) mem) => (LoweredPanicBoundsRC [kind] x {PanicBoundsC{C:c}} mem)
|
||||
(LoweredPanicBoundsRR [kind] (MOVDconst [c]) y mem) => (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:c}} y mem)
|
||||
(LoweredPanicBoundsRC [kind] {p} (MOVDconst [c]) mem) => (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:c, Cy:p.C}} mem)
|
||||
(LoweredPanicBoundsCR [kind] {p} (MOVDconst [c]) mem) => (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:p.C, Cy:c}} mem)
|
||||
|
||||
// Optimizations
|
||||
|
||||
|
|
@ -683,6 +685,14 @@
|
|||
((EQ|NE) (CMPconst [0] x) yes no) => ((Z|NZ) x yes no)
|
||||
((EQ|NE) (CMPWconst [0] x) yes no) => ((ZW|NZW) x yes no)
|
||||
|
||||
((ULE|UGT) (CMPconst [0] x)) => ((EQ|NE) (CMPconst [0] x))
|
||||
((ULE|UGT) (CMPWconst [0] x)) => ((EQ|NE) (CMPWconst [0] x))
|
||||
|
||||
((Z|NZ) sub:(SUB x y)) && sub.Uses == 1 => ((EQ|NE) (CMP x y))
|
||||
((ZW|NZW) sub:(SUB x y)) && sub.Uses == 1 => ((EQ|NE) (CMPW x y))
|
||||
((Z|NZ) sub:(SUBconst [c] y)) && sub.Uses == 1 => ((EQ|NE) (CMPconst [c] y))
|
||||
((ZW|NZW) sub:(SUBconst [c] y)) && sub.Uses == 1 => ((EQ|NE) (CMPWconst [int32(c)] y))
|
||||
|
||||
((EQ|NE|LT|LE|GT|GE) (CMPconst [0] z:(MADD a x y)) yes no) && z.Uses==1 => ((EQ|NE|LTnoov|LEnoov|GTnoov|GEnoov) (CMN a (MUL <x.Type> x y)) yes no)
|
||||
((EQ|NE|LT|LE|GT|GE) (CMPconst [0] z:(MSUB a x y)) yes no) && z.Uses==1 => ((EQ|NE|LTnoov|LEnoov|GTnoov|GEnoov) (CMP a (MUL <x.Type> x y)) yes no)
|
||||
((EQ|NE|LT|LE|GT|GE) (CMPWconst [0] z:(MADDW a x y)) yes no) && z.Uses==1 => ((EQ|NE|LTnoov|LEnoov|GTnoov|GEnoov) (CMNW a (MULW <x.Type> x y)) yes no)
|
||||
|
|
@ -1658,6 +1668,10 @@
|
|||
(SRLconst [rc] (MOVHUreg x)) && rc >= 16 => (MOVDconst [0])
|
||||
(SRLconst [rc] (MOVBUreg x)) && rc >= 8 => (MOVDconst [0])
|
||||
|
||||
// Special cases for slice operations
|
||||
(ADD x0 x1:(ANDshiftRA x2:(SLLconst [sl] y) z [63])) && x1.Uses == 1 && x2.Uses == 1 => (ADDshiftLL x0 (ANDshiftRA <y.Type> y z [63]) [sl])
|
||||
(ADD x0 x1:(ANDshiftLL x2:(SRAconst [63] z) y [sl])) && x1.Uses == 1 && x2.Uses == 1 => (ADDshiftLL x0 (ANDshiftRA <y.Type> y z [63]) [sl])
|
||||
|
||||
// bitfield ops
|
||||
|
||||
// sbfiz
|
||||
|
|
|
|||
|
|
@ -144,11 +144,8 @@ func init() {
|
|||
gpspsbg = gpspg | buildReg("SB")
|
||||
fp = buildReg("F0 F1 F2 F3 F4 F5 F6 F7 F8 F9 F10 F11 F12 F13 F14 F15 F16 F17 F18 F19 F20 F21 F22 F23 F24 F25 F26 F27 F28 F29 F30 F31")
|
||||
callerSave = gp | fp | buildReg("g") // runtime.setg (and anything calling it) may clobber g
|
||||
r0 = buildReg("R0")
|
||||
r1 = buildReg("R1")
|
||||
r2 = buildReg("R2")
|
||||
r3 = buildReg("R3")
|
||||
rz = buildReg("ZERO")
|
||||
first16 = buildReg("R0 R1 R2 R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15")
|
||||
)
|
||||
// Common regInfo
|
||||
var (
|
||||
|
|
@ -760,12 +757,15 @@ func init() {
|
|||
// Returns a pointer to a write barrier buffer in R25.
|
||||
{name: "LoweredWB", argLength: 1, reg: regInfo{clobbers: (callerSave &^ gpg) | buildReg("R16 R17 R30"), outputs: []regMask{buildReg("R25")}}, clobberFlags: true, aux: "Int64"},
|
||||
|
||||
// There are three of these functions so that they can have three different register inputs.
|
||||
// When we check 0 <= c <= cap (A), then 0 <= b <= c (B), then 0 <= a <= b (C), we want the
|
||||
// default registers to match so we don't need to copy registers around unnecessarily.
|
||||
{name: "LoweredPanicBoundsA", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{r2, r3}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in generic.go).
|
||||
{name: "LoweredPanicBoundsB", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{r1, r2}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in generic.go).
|
||||
{name: "LoweredPanicBoundsC", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{r0, r1}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in generic.go).
|
||||
// LoweredPanicBoundsRR takes x and y, two values that caused a bounds check to fail.
|
||||
// the RC and CR versions are used when one of the arguments is a constant. CC is used
|
||||
// when both are constant (normally both 0, as prove derives the fact that a [0] bounds
|
||||
// failure means the length must have also been 0).
|
||||
// AuxInt contains a report code (see PanicBounds in genericOps.go).
|
||||
{name: "LoweredPanicBoundsRR", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{first16, first16}}, typ: "Mem", call: true}, // arg0=x, arg1=y, arg2=mem, returns memory.
|
||||
{name: "LoweredPanicBoundsRC", argLength: 2, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{first16}}, typ: "Mem", call: true}, // arg0=x, arg1=mem, returns memory.
|
||||
{name: "LoweredPanicBoundsCR", argLength: 2, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{first16}}, typ: "Mem", call: true}, // arg0=y, arg1=mem, returns memory.
|
||||
{name: "LoweredPanicBoundsCC", argLength: 1, aux: "PanicBoundsCC", reg: regInfo{}, typ: "Mem", call: true}, // arg0=mem, returns memory.
|
||||
|
||||
// Prefetch instruction
|
||||
// Do prefetch arg0 address with option aux. arg0=addr, arg1=memory, aux=option.
|
||||
|
|
|
|||
|
|
@ -94,11 +94,11 @@ func init() {
|
|||
gpspsbg = gpspg | buildReg("SB")
|
||||
fp = buildReg("F0 F1 F2 F3 F4 F5 F6 F7 F8 F9 F10 F11 F12 F13 F14 F15")
|
||||
callerSave = gp | fp | buildReg("g") // runtime.setg (and anything calling it) may clobber g
|
||||
lr = buildReg("R14")
|
||||
r0 = buildReg("R0")
|
||||
r1 = buildReg("R1")
|
||||
r2 = buildReg("R2")
|
||||
r3 = buildReg("R3")
|
||||
r4 = buildReg("R4")
|
||||
)
|
||||
// Common regInfo
|
||||
var (
|
||||
|
|
@ -540,16 +540,19 @@ func init() {
|
|||
// See runtime/stubs.go for a more detailed discussion.
|
||||
{name: "LoweredGetCallerPC", reg: gp01, rematerializeable: true},
|
||||
|
||||
// There are three of these functions so that they can have three different register inputs.
|
||||
// When we check 0 <= c <= cap (A), then 0 <= b <= c (B), then 0 <= a <= b (C), we want the
|
||||
// default registers to match so we don't need to copy registers around unnecessarily.
|
||||
{name: "LoweredPanicBoundsA", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{r2, r3}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in genericOps.go).
|
||||
{name: "LoweredPanicBoundsB", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{r1, r2}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in genericOps.go).
|
||||
{name: "LoweredPanicBoundsC", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{r0, r1}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in genericOps.go).
|
||||
// Extend ops are the same as Bounds ops except the indexes are 64-bit.
|
||||
{name: "LoweredPanicExtendA", argLength: 4, aux: "Int64", reg: regInfo{inputs: []regMask{r4, r2, r3}}, typ: "Mem", call: true}, // arg0=idxHi, arg1=idxLo, arg2=len, arg3=mem, returns memory. AuxInt contains report code (see PanicExtend in genericOps.go).
|
||||
{name: "LoweredPanicExtendB", argLength: 4, aux: "Int64", reg: regInfo{inputs: []regMask{r4, r1, r2}}, typ: "Mem", call: true}, // arg0=idxHi, arg1=idxLo, arg2=len, arg3=mem, returns memory. AuxInt contains report code (see PanicExtend in genericOps.go).
|
||||
{name: "LoweredPanicExtendC", argLength: 4, aux: "Int64", reg: regInfo{inputs: []regMask{r4, r0, r1}}, typ: "Mem", call: true}, // arg0=idxHi, arg1=idxLo, arg2=len, arg3=mem, returns memory. AuxInt contains report code (see PanicExtend in genericOps.go).
|
||||
// LoweredPanicBoundsRR takes x and y, two values that caused a bounds check to fail.
|
||||
// the RC and CR versions are used when one of the arguments is a constant. CC is used
|
||||
// when both are constant (normally both 0, as prove derives the fact that a [0] bounds
|
||||
// failure means the length must have also been 0).
|
||||
// AuxInt contains a report code (see PanicBounds in genericOps.go).
|
||||
{name: "LoweredPanicBoundsRR", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{gp &^ lr, gp &^ lr}}, typ: "Mem", call: true}, // arg0=x, arg1=y, arg2=mem, returns memory.
|
||||
{name: "LoweredPanicBoundsRC", argLength: 2, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{gp &^ lr}}, typ: "Mem", call: true}, // arg0=x, arg1=mem, returns memory.
|
||||
{name: "LoweredPanicBoundsCR", argLength: 2, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{gp &^ lr}}, typ: "Mem", call: true}, // arg0=y, arg1=mem, returns memory.
|
||||
{name: "LoweredPanicBoundsCC", argLength: 1, aux: "PanicBoundsCC", reg: regInfo{}, typ: "Mem", call: true}, // arg0=mem, returns memory.
|
||||
|
||||
// Same as above, but the x value is 64 bits.
|
||||
{name: "LoweredPanicExtendRR", argLength: 4, aux: "Int64", reg: regInfo{inputs: []regMask{r0 | r1 | r2 | r3, r0 | r1 | r2 | r3, gp}}, typ: "Mem", call: true}, // arg0=x_hi, arg1=x_lo, arg2=y, arg3=mem, returns memory.
|
||||
{name: "LoweredPanicExtendRC", argLength: 3, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{r0 | r1 | r2 | r3, r0 | r1 | r2 | r3}}, typ: "Mem", call: true}, // arg0=x_hi, arg1=x_lo, arg2=mem, returns memory.
|
||||
|
||||
// Constant flag value.
|
||||
// Note: there's an "unordered" outcome for floating-point
|
||||
|
|
|
|||
|
|
@ -527,9 +527,11 @@
|
|||
// Publication barrier as intrinsic
|
||||
(PubBarrier ...) => (LoweredPubBarrier ...)
|
||||
|
||||
(PanicBounds [kind] x y mem) && boundsABI(kind) == 0 => (LoweredPanicBoundsA [kind] x y mem)
|
||||
(PanicBounds [kind] x y mem) && boundsABI(kind) == 1 => (LoweredPanicBoundsB [kind] x y mem)
|
||||
(PanicBounds [kind] x y mem) && boundsABI(kind) == 2 => (LoweredPanicBoundsC [kind] x y mem)
|
||||
(PanicBounds ...) => (LoweredPanicBoundsRR ...)
|
||||
(LoweredPanicBoundsRR [kind] x (MOVVconst [c]) mem) => (LoweredPanicBoundsRC [kind] x {PanicBoundsC{C:c}} mem)
|
||||
(LoweredPanicBoundsRR [kind] (MOVVconst [c]) y mem) => (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:c}} y mem)
|
||||
(LoweredPanicBoundsRC [kind] {p} (MOVVconst [c]) mem) => (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:c, Cy:p.C}} mem)
|
||||
(LoweredPanicBoundsCR [kind] {p} (MOVVconst [c]) mem) => (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:p.C, Cy:c}} mem)
|
||||
|
||||
(CondSelect <t> x y cond) => (OR (MASKEQZ <t> x cond) (MASKNEZ <t> y cond))
|
||||
|
||||
|
|
@ -748,10 +750,10 @@
|
|||
(SRLVconst [rc] (MOVBUreg x)) && rc >= 8 => (MOVVconst [0])
|
||||
|
||||
// mul by constant
|
||||
(MULV x (MOVVconst [-1])) => (NEGV x)
|
||||
(MULV _ (MOVVconst [0])) => (MOVVconst [0])
|
||||
(MULV x (MOVVconst [1])) => x
|
||||
(MULV x (MOVVconst [c])) && isPowerOfTwo(c) => (SLLVconst [log64(c)] x)
|
||||
|
||||
(MULV x (MOVVconst [c])) && canMulStrengthReduce(config, c) => {mulStrengthReduce(v, x, c)}
|
||||
|
||||
// div by constant
|
||||
(DIVVU x (MOVVconst [1])) => x
|
||||
|
|
@ -843,6 +845,14 @@
|
|||
|
||||
(MOVBUreg (ANDconst [c] x)) => (ANDconst [c&0xff] x)
|
||||
|
||||
// Avoid extending when already sufficiently masked.
|
||||
(MOVBreg x:(ANDconst [c] y)) && c >= 0 && int64(int8(c)) == c => x
|
||||
(MOVHreg x:(ANDconst [c] y)) && c >= 0 && int64(int16(c)) == c => x
|
||||
(MOVWreg x:(ANDconst [c] y)) && c >= 0 && int64(int32(c)) == c => x
|
||||
(MOVBUreg x:(ANDconst [c] y)) && c >= 0 && int64(uint8(c)) == c => x
|
||||
(MOVHUreg x:(ANDconst [c] y)) && c >= 0 && int64(uint16(c)) == c => x
|
||||
(MOVWUreg x:(ANDconst [c] y)) && c >= 0 && int64(uint32(c)) == c => x
|
||||
|
||||
// Prefetch instructions (hint specified using aux field)
|
||||
// For PRELD{,X} A value of hint indicates:
|
||||
// hint=0 is defined as load prefetch to L1-cache
|
||||
|
|
|
|||
|
|
@ -130,10 +130,7 @@ func init() {
|
|||
gpspsbg = gpspg | buildReg("SB")
|
||||
fp = buildReg("F0 F1 F2 F3 F4 F5 F6 F7 F8 F9 F10 F11 F12 F13 F14 F15 F16 F17 F18 F19 F20 F21 F22 F23 F24 F25 F26 F27 F28 F29 F30 F31")
|
||||
callerSave = gp | fp | buildReg("g") // runtime.setg (and anything calling it) may clobber g
|
||||
r1 = buildReg("R20")
|
||||
r2 = buildReg("R21")
|
||||
r3 = buildReg("R23")
|
||||
r4 = buildReg("R24")
|
||||
first16 = buildReg("R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 R16 R17 R18 R19")
|
||||
)
|
||||
// Common regInfo
|
||||
var (
|
||||
|
|
@ -563,12 +560,15 @@ func init() {
|
|||
// Do data barrier. arg0=memorys
|
||||
{name: "LoweredPubBarrier", argLength: 1, asm: "DBAR", hasSideEffects: true},
|
||||
|
||||
// There are three of these functions so that they can have three different register inputs.
|
||||
// When we check 0 <= c <= cap (A), then 0 <= b <= c (B), then 0 <= a <= b (C), we want the
|
||||
// default registers to match so we don't need to copy registers around unnecessarily.
|
||||
{name: "LoweredPanicBoundsA", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{r3, r4}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in genericOps.go).
|
||||
{name: "LoweredPanicBoundsB", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{r2, r3}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in genericOps.go).
|
||||
{name: "LoweredPanicBoundsC", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{r1, r2}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in genericOps.go).
|
||||
// LoweredPanicBoundsRR takes x and y, two values that caused a bounds check to fail.
|
||||
// the RC and CR versions are used when one of the arguments is a constant. CC is used
|
||||
// when both are constant (normally both 0, as prove derives the fact that a [0] bounds
|
||||
// failure means the length must have also been 0).
|
||||
// AuxInt contains a report code (see PanicBounds in genericOps.go).
|
||||
{name: "LoweredPanicBoundsRR", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{first16, first16}}, typ: "Mem", call: true}, // arg0=x, arg1=y, arg2=mem, returns memory.
|
||||
{name: "LoweredPanicBoundsRC", argLength: 2, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{first16}}, typ: "Mem", call: true}, // arg0=x, arg1=mem, returns memory.
|
||||
{name: "LoweredPanicBoundsCR", argLength: 2, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{first16}}, typ: "Mem", call: true}, // arg0=y, arg1=mem, returns memory.
|
||||
{name: "LoweredPanicBoundsCC", argLength: 1, aux: "PanicBoundsCC", reg: regInfo{}, typ: "Mem", call: true}, // arg0=mem, returns memory.
|
||||
|
||||
// Prefetch instruction
|
||||
// Do prefetch arg0 address with option aux. arg0=addr, arg1=memory, aux=option.
|
||||
|
|
|
|||
6
src/cmd/compile/internal/ssa/_gen/LOONG64latelower.rules
Normal file
6
src/cmd/compile/internal/ssa/_gen/LOONG64latelower.rules
Normal file
|
|
@ -0,0 +1,6 @@
|
|||
// Copyright 2025 The Go Authors. All rights reserved.
|
||||
// Use of this source code is governed by a BSD-style
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
// Prefer addition when shifting left by one.
|
||||
(SLLVconst [1] x) => (ADDV x x)
|
||||
|
|
@ -423,13 +423,17 @@
|
|||
// Publication barrier as intrinsic
|
||||
(PubBarrier ...) => (LoweredPubBarrier ...)
|
||||
|
||||
(PanicBounds [kind] x y mem) && boundsABI(kind) == 0 => (LoweredPanicBoundsA [kind] x y mem)
|
||||
(PanicBounds [kind] x y mem) && boundsABI(kind) == 1 => (LoweredPanicBoundsB [kind] x y mem)
|
||||
(PanicBounds [kind] x y mem) && boundsABI(kind) == 2 => (LoweredPanicBoundsC [kind] x y mem)
|
||||
|
||||
(PanicExtend [kind] hi lo y mem) && boundsABI(kind) == 0 => (LoweredPanicExtendA [kind] hi lo y mem)
|
||||
(PanicExtend [kind] hi lo y mem) && boundsABI(kind) == 1 => (LoweredPanicExtendB [kind] hi lo y mem)
|
||||
(PanicExtend [kind] hi lo y mem) && boundsABI(kind) == 2 => (LoweredPanicExtendC [kind] hi lo y mem)
|
||||
(PanicBounds ...) => (LoweredPanicBoundsRR ...)
|
||||
(PanicExtend ...) => (LoweredPanicExtendRR ...)
|
||||
|
||||
(LoweredPanicBoundsRR [kind] x (MOVWconst [c]) mem) => (LoweredPanicBoundsRC [kind] x {PanicBoundsC{C:int64(c)}} mem)
|
||||
(LoweredPanicBoundsRR [kind] (MOVWconst [c]) y mem) => (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:int64(c)}} y mem)
|
||||
(LoweredPanicBoundsRC [kind] {p} (MOVWconst [c]) mem) => (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:int64(c), Cy:p.C}} mem)
|
||||
|
||||
(LoweredPanicExtendRR [kind] hi lo (MOVWconst [c]) mem) => (LoweredPanicExtendRC [kind] hi lo {PanicBoundsC{C:int64(c)}} mem)
|
||||
(LoweredPanicExtendRR [kind] (MOVWconst [hi]) (MOVWconst [lo]) y mem) => (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:int64(hi)<<32 + int64(uint32(lo))}} y mem)
|
||||
(LoweredPanicExtendRC [kind] {p} (MOVWconst [hi]) (MOVWconst [lo]) mem) => (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:int64(hi)<<32+int64(uint32(lo)), Cy:p.C}} mem)
|
||||
|
||||
// Optimizations
|
||||
|
||||
|
|
@ -607,13 +611,13 @@
|
|||
(Select0 (MULTU (MOVWconst [1]) _ )) => (MOVWconst [0])
|
||||
(Select1 (MULTU (MOVWconst [-1]) x )) => (NEG <x.Type> x)
|
||||
(Select0 (MULTU (MOVWconst [-1]) x )) => (CMOVZ (ADDconst <x.Type> [-1] x) (MOVWconst [0]) x)
|
||||
(Select1 (MULTU (MOVWconst [c]) x )) && isPowerOfTwo(int64(uint32(c))) => (SLLconst [int32(log2uint32(int64(c)))] x)
|
||||
(Select0 (MULTU (MOVWconst [c]) x )) && isPowerOfTwo(int64(uint32(c))) => (SRLconst [int32(32-log2uint32(int64(c)))] x)
|
||||
(Select1 (MULTU (MOVWconst [c]) x )) && isUnsignedPowerOfTwo(uint32(c)) => (SLLconst [int32(log32u(uint32(c)))] x)
|
||||
(Select0 (MULTU (MOVWconst [c]) x )) && isUnsignedPowerOfTwo(uint32(c)) => (SRLconst [int32(32-log32u(uint32(c)))] x)
|
||||
|
||||
(MUL (MOVWconst [0]) _ ) => (MOVWconst [0])
|
||||
(MUL (MOVWconst [1]) x ) => x
|
||||
(MUL (MOVWconst [-1]) x ) => (NEG x)
|
||||
(MUL (MOVWconst [c]) x ) && isPowerOfTwo(int64(uint32(c))) => (SLLconst [int32(log2uint32(int64(c)))] x)
|
||||
(MUL (MOVWconst [c]) x ) && isUnsignedPowerOfTwo(uint32(c)) => (SLLconst [int32(log32u(uint32(c)))] x)
|
||||
|
||||
// generic simplifications
|
||||
(ADD x (NEG y)) => (SUB x y)
|
||||
|
|
|
|||
|
|
@ -479,9 +479,11 @@
|
|||
// Publication barrier as intrinsic
|
||||
(PubBarrier ...) => (LoweredPubBarrier ...)
|
||||
|
||||
(PanicBounds [kind] x y mem) && boundsABI(kind) == 0 => (LoweredPanicBoundsA [kind] x y mem)
|
||||
(PanicBounds [kind] x y mem) && boundsABI(kind) == 1 => (LoweredPanicBoundsB [kind] x y mem)
|
||||
(PanicBounds [kind] x y mem) && boundsABI(kind) == 2 => (LoweredPanicBoundsC [kind] x y mem)
|
||||
(PanicBounds ...) => (LoweredPanicBoundsRR ...)
|
||||
(LoweredPanicBoundsRR [kind] x (MOVVconst [c]) mem) => (LoweredPanicBoundsRC [kind] x {PanicBoundsC{C:c}} mem)
|
||||
(LoweredPanicBoundsRR [kind] (MOVVconst [c]) y mem) => (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:c}} y mem)
|
||||
(LoweredPanicBoundsRC [kind] {p} (MOVVconst [c]) mem) => (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:c, Cy:p.C}} mem)
|
||||
(LoweredPanicBoundsCR [kind] {p} (MOVVconst [c]) mem) => (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:p.C, Cy:c}} mem)
|
||||
|
||||
// Optimizations
|
||||
|
||||
|
|
|
|||
|
|
@ -136,10 +136,7 @@ func init() {
|
|||
lo = buildReg("LO")
|
||||
hi = buildReg("HI")
|
||||
callerSave = gp | fp | lo | hi | buildReg("g") // runtime.setg (and anything calling it) may clobber g
|
||||
r1 = buildReg("R1")
|
||||
r2 = buildReg("R2")
|
||||
r3 = buildReg("R3")
|
||||
r4 = buildReg("R4")
|
||||
first16 = buildReg("R1 R2 R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 R16")
|
||||
)
|
||||
// Common regInfo
|
||||
var (
|
||||
|
|
@ -469,12 +466,15 @@ func init() {
|
|||
// Do data barrier. arg0=memorys
|
||||
{name: "LoweredPubBarrier", argLength: 1, asm: "SYNC", hasSideEffects: true},
|
||||
|
||||
// There are three of these functions so that they can have three different register inputs.
|
||||
// When we check 0 <= c <= cap (A), then 0 <= b <= c (B), then 0 <= a <= b (C), we want the
|
||||
// default registers to match so we don't need to copy registers around unnecessarily.
|
||||
{name: "LoweredPanicBoundsA", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{r3, r4}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in genericOps.go).
|
||||
{name: "LoweredPanicBoundsB", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{r2, r3}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in genericOps.go).
|
||||
{name: "LoweredPanicBoundsC", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{r1, r2}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in genericOps.go).
|
||||
// LoweredPanicBoundsRR takes x and y, two values that caused a bounds check to fail.
|
||||
// the RC and CR versions are used when one of the arguments is a constant. CC is used
|
||||
// when both are constant (normally both 0, as prove derives the fact that a [0] bounds
|
||||
// failure means the length must have also been 0).
|
||||
// AuxInt contains a report code (see PanicBounds in genericOps.go).
|
||||
{name: "LoweredPanicBoundsRR", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{first16, first16}}, typ: "Mem", call: true}, // arg0=x, arg1=y, arg2=mem, returns memory.
|
||||
{name: "LoweredPanicBoundsRC", argLength: 2, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{first16}}, typ: "Mem", call: true}, // arg0=x, arg1=mem, returns memory.
|
||||
{name: "LoweredPanicBoundsCR", argLength: 2, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{first16}}, typ: "Mem", call: true}, // arg0=y, arg1=mem, returns memory.
|
||||
{name: "LoweredPanicBoundsCC", argLength: 1, aux: "PanicBoundsCC", reg: regInfo{}, typ: "Mem", call: true}, // arg0=mem, returns memory.
|
||||
}
|
||||
|
||||
blocks := []blockData{
|
||||
|
|
|
|||
|
|
@ -120,11 +120,8 @@ func init() {
|
|||
lo = buildReg("LO")
|
||||
hi = buildReg("HI")
|
||||
callerSave = gp | fp | lo | hi | buildReg("g") // runtime.setg (and anything calling it) may clobber g
|
||||
r1 = buildReg("R1")
|
||||
r2 = buildReg("R2")
|
||||
r3 = buildReg("R3")
|
||||
r4 = buildReg("R4")
|
||||
r5 = buildReg("R5")
|
||||
first16 = buildReg("R1 R2 R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 R16")
|
||||
first4 = buildReg("R1 R2 R3 R4")
|
||||
)
|
||||
// Common regInfo
|
||||
var (
|
||||
|
|
@ -411,16 +408,19 @@ func init() {
|
|||
// Do data barrier. arg0=memorys
|
||||
{name: "LoweredPubBarrier", argLength: 1, asm: "SYNC", hasSideEffects: true},
|
||||
|
||||
// There are three of these functions so that they can have three different register inputs.
|
||||
// When we check 0 <= c <= cap (A), then 0 <= b <= c (B), then 0 <= a <= b (C), we want the
|
||||
// default registers to match so we don't need to copy registers around unnecessarily.
|
||||
{name: "LoweredPanicBoundsA", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{r3, r4}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in genericOps.go).
|
||||
{name: "LoweredPanicBoundsB", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{r2, r3}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in genericOps.go).
|
||||
{name: "LoweredPanicBoundsC", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{r1, r2}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in genericOps.go).
|
||||
// Extend ops are the same as Bounds ops except the indexes are 64-bit.
|
||||
{name: "LoweredPanicExtendA", argLength: 4, aux: "Int64", reg: regInfo{inputs: []regMask{r5, r3, r4}}, typ: "Mem", call: true}, // arg0=idxHi, arg1=idxLo, arg2=len, arg3=mem, returns memory. AuxInt contains report code (see PanicExtend in genericOps.go).
|
||||
{name: "LoweredPanicExtendB", argLength: 4, aux: "Int64", reg: regInfo{inputs: []regMask{r5, r2, r3}}, typ: "Mem", call: true}, // arg0=idxHi, arg1=idxLo, arg2=len, arg3=mem, returns memory. AuxInt contains report code (see PanicExtend in genericOps.go).
|
||||
{name: "LoweredPanicExtendC", argLength: 4, aux: "Int64", reg: regInfo{inputs: []regMask{r5, r1, r2}}, typ: "Mem", call: true}, // arg0=idxHi, arg1=idxLo, arg2=len, arg3=mem, returns memory. AuxInt contains report code (see PanicExtend in genericOps.go).
|
||||
// LoweredPanicBoundsRR takes x and y, two values that caused a bounds check to fail.
|
||||
// the RC and CR versions are used when one of the arguments is a constant. CC is used
|
||||
// when both are constant (normally both 0, as prove derives the fact that a [0] bounds
|
||||
// failure means the length must have also been 0).
|
||||
// AuxInt contains a report code (see PanicBounds in genericOps.go).
|
||||
{name: "LoweredPanicBoundsRR", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{first16, first16}}, typ: "Mem", call: true}, // arg0=x, arg1=y, arg2=mem, returns memory.
|
||||
{name: "LoweredPanicBoundsRC", argLength: 2, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{first16}}, typ: "Mem", call: true}, // arg0=x, arg1=mem, returns memory.
|
||||
{name: "LoweredPanicBoundsCR", argLength: 2, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{first16}}, typ: "Mem", call: true}, // arg0=y, arg1=mem, returns memory.
|
||||
{name: "LoweredPanicBoundsCC", argLength: 1, aux: "PanicBoundsCC", reg: regInfo{}, typ: "Mem", call: true}, // arg0=mem, returns memory.
|
||||
|
||||
// Same as above, but the x value is 64 bits.
|
||||
{name: "LoweredPanicExtendRR", argLength: 4, aux: "Int64", reg: regInfo{inputs: []regMask{first4, first4, first16}}, typ: "Mem", call: true}, // arg0=x_hi, arg1=x_lo, arg2=y, arg3=mem, returns memory.
|
||||
{name: "LoweredPanicExtendRC", argLength: 3, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{first4, first4}}, typ: "Mem", call: true}, // arg0=x_hi, arg1=x_lo, arg2=mem, returns memory.
|
||||
}
|
||||
|
||||
blocks := []blockData{
|
||||
|
|
|
|||
|
|
@ -407,9 +407,11 @@
|
|||
// Publication barrier as intrinsic
|
||||
(PubBarrier ...) => (LoweredPubBarrier ...)
|
||||
|
||||
(PanicBounds [kind] x y mem) && boundsABI(kind) == 0 => (LoweredPanicBoundsA [kind] x y mem)
|
||||
(PanicBounds [kind] x y mem) && boundsABI(kind) == 1 => (LoweredPanicBoundsB [kind] x y mem)
|
||||
(PanicBounds [kind] x y mem) && boundsABI(kind) == 2 => (LoweredPanicBoundsC [kind] x y mem)
|
||||
(PanicBounds ...) => (LoweredPanicBoundsRR ...)
|
||||
(LoweredPanicBoundsRR [kind] x (MOVDconst [c]) mem) => (LoweredPanicBoundsRC [kind] x {PanicBoundsC{C:c}} mem)
|
||||
(LoweredPanicBoundsRR [kind] (MOVDconst [c]) y mem) => (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:c}} y mem)
|
||||
(LoweredPanicBoundsRC [kind] {p} (MOVDconst [c]) mem) => (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:c, Cy:p.C}} mem)
|
||||
(LoweredPanicBoundsCR [kind] {p} (MOVDconst [c]) mem) => (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:p.C, Cy:c}} mem)
|
||||
|
||||
// Small moves
|
||||
(Move [0] _ _ mem) => mem
|
||||
|
|
|
|||
|
|
@ -49,7 +49,7 @@ func riscv64RegName(r int) string {
|
|||
|
||||
func init() {
|
||||
var regNamesRISCV64 []string
|
||||
var gpMask, fpMask, gpgMask, gpspMask, gpspsbMask, gpspsbgMask regMask
|
||||
var gpMask, fpMask, gpgMask, gpspMask, gpspsbMask, gpspsbgMask, first16Mask regMask
|
||||
regNamed := make(map[string]regMask)
|
||||
|
||||
// Build the list of register names, creating an appropriately indexed
|
||||
|
|
@ -93,6 +93,9 @@ func init() {
|
|||
gpspMask |= mask
|
||||
gpspsbMask |= mask
|
||||
gpspsbgMask |= mask
|
||||
if r >= 5 && r < 5+16 {
|
||||
first16Mask |= mask
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
|
|
@ -429,12 +432,15 @@ func init() {
|
|||
// Do data barrier. arg0=memorys
|
||||
{name: "LoweredPubBarrier", argLength: 1, asm: "FENCE", hasSideEffects: true},
|
||||
|
||||
// There are three of these functions so that they can have three different register inputs.
|
||||
// When we check 0 <= c <= cap (A), then 0 <= b <= c (B), then 0 <= a <= b (C), we want the
|
||||
// default registers to match so we don't need to copy registers around unnecessarily.
|
||||
{name: "LoweredPanicBoundsA", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{regNamed["X7"], regNamed["X28"]}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in genericOps.go).
|
||||
{name: "LoweredPanicBoundsB", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{regNamed["X6"], regNamed["X7"]}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in genericOps.go).
|
||||
{name: "LoweredPanicBoundsC", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{regNamed["X5"], regNamed["X6"]}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in genericOps.go).
|
||||
// LoweredPanicBoundsRR takes x and y, two values that caused a bounds check to fail.
|
||||
// the RC and CR versions are used when one of the arguments is a constant. CC is used
|
||||
// when both are constant (normally both 0, as prove derives the fact that a [0] bounds
|
||||
// failure means the length must have also been 0).
|
||||
// AuxInt contains a report code (see PanicBounds in genericOps.go).
|
||||
{name: "LoweredPanicBoundsRR", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{first16Mask, first16Mask}}, typ: "Mem", call: true}, // arg0=x, arg1=y, arg2=mem, returns memory.
|
||||
{name: "LoweredPanicBoundsRC", argLength: 2, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{first16Mask}}, typ: "Mem", call: true}, // arg0=x, arg1=mem, returns memory.
|
||||
{name: "LoweredPanicBoundsCR", argLength: 2, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{first16Mask}}, typ: "Mem", call: true}, // arg0=y, arg1=mem, returns memory.
|
||||
{name: "LoweredPanicBoundsCC", argLength: 1, aux: "PanicBoundsCC", reg: regInfo{}, typ: "Mem", call: true}, // arg0=mem, returns memory.
|
||||
|
||||
// F extension.
|
||||
{name: "FADDS", argLength: 2, reg: fp21, asm: "FADDS", commutative: true, typ: "Float32"}, // arg0 + arg1
|
||||
|
|
|
|||
|
|
@ -145,6 +145,9 @@
|
|||
|
||||
(Sqrt32 ...) => (FSQRTS ...)
|
||||
|
||||
(Max(64|32)F ...) => (WFMAX(D|S)B ...)
|
||||
(Min(64|32)F ...) => (WFMIN(D|S)B ...)
|
||||
|
||||
// Atomic loads and stores.
|
||||
// The SYNC instruction (fast-BCR-serialization) prevents store-load
|
||||
// reordering. Other sequences of memory operations (load-load,
|
||||
|
|
@ -455,9 +458,11 @@
|
|||
// Write barrier.
|
||||
(WB ...) => (LoweredWB ...)
|
||||
|
||||
(PanicBounds [kind] x y mem) && boundsABI(kind) == 0 => (LoweredPanicBoundsA [kind] x y mem)
|
||||
(PanicBounds [kind] x y mem) && boundsABI(kind) == 1 => (LoweredPanicBoundsB [kind] x y mem)
|
||||
(PanicBounds [kind] x y mem) && boundsABI(kind) == 2 => (LoweredPanicBoundsC [kind] x y mem)
|
||||
(PanicBounds ...) => (LoweredPanicBoundsRR ...)
|
||||
(LoweredPanicBoundsRR [kind] x (MOVDconst [c]) mem) => (LoweredPanicBoundsRC [kind] x {PanicBoundsC{C:c}} mem)
|
||||
(LoweredPanicBoundsRR [kind] (MOVDconst [c]) y mem) => (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:c}} y mem)
|
||||
(LoweredPanicBoundsRC [kind] {p} (MOVDconst [c]) mem) => (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:c, Cy:p.C}} mem)
|
||||
(LoweredPanicBoundsCR [kind] {p} (MOVDconst [c]) mem) => (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:p.C, Cy:c}} mem)
|
||||
|
||||
// ***************************
|
||||
// Above: lowering rules
|
||||
|
|
|
|||
|
|
@ -114,6 +114,7 @@ func init() {
|
|||
sb = buildReg("SB")
|
||||
r0 = buildReg("R0")
|
||||
tmp = buildReg("R11") // R11 is used as a temporary in a small number of instructions.
|
||||
lr = buildReg("R14")
|
||||
|
||||
// R10 is reserved by the assembler.
|
||||
gp = buildReg("R0 R1 R2 R3 R4 R5 R6 R7 R8 R9 R11 R12 R14")
|
||||
|
|
@ -222,6 +223,12 @@ func init() {
|
|||
{name: "LNDFR", argLength: 1, reg: fp11, asm: "LNDFR"}, // fp64/fp32 clear sign bit
|
||||
{name: "CPSDR", argLength: 2, reg: fp21, asm: "CPSDR"}, // fp64/fp32 copy arg1 sign bit to arg0
|
||||
|
||||
// Single element vector floating point min / max instructions
|
||||
{name: "WFMAXDB", argLength: 2, reg: fp21, asm: "WFMAXDB", typ: "Float64"}, // max[float64](arg0, arg1)
|
||||
{name: "WFMAXSB", argLength: 2, reg: fp21, asm: "WFMAXSB", typ: "Float32"}, // max[float32](arg0, arg1)
|
||||
{name: "WFMINDB", argLength: 2, reg: fp21, asm: "WFMINDB", typ: "Float64"}, // min[float64](arg0, arg1)
|
||||
{name: "WFMINSB", argLength: 2, reg: fp21, asm: "WFMINSB", typ: "Float32"}, // min[float32](arg0, arg1)
|
||||
|
||||
// Round to integer, float64 only.
|
||||
//
|
||||
// aux | rounding mode
|
||||
|
|
@ -512,12 +519,15 @@ func init() {
|
|||
// Returns a pointer to a write barrier buffer in R9.
|
||||
{name: "LoweredWB", argLength: 1, reg: regInfo{clobbers: (callerSave &^ gpg) | buildReg("R14") | r1, outputs: []regMask{r9}}, clobberFlags: true, aux: "Int64"},
|
||||
|
||||
// There are three of these functions so that they can have three different register inputs.
|
||||
// When we check 0 <= c <= cap (A), then 0 <= b <= c (B), then 0 <= a <= b (C), we want the
|
||||
// default registers to match so we don't need to copy registers around unnecessarily.
|
||||
{name: "LoweredPanicBoundsA", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{r2, r3}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in generic.go).
|
||||
{name: "LoweredPanicBoundsB", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{r1, r2}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in generic.go).
|
||||
{name: "LoweredPanicBoundsC", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{r0, r1}}, typ: "Mem", call: true}, // arg0=idx, arg1=len, arg2=mem, returns memory. AuxInt contains report code (see PanicBounds in generic.go).
|
||||
// LoweredPanicBoundsRR takes x and y, two values that caused a bounds check to fail.
|
||||
// the RC and CR versions are used when one of the arguments is a constant. CC is used
|
||||
// when both are constant (normally both 0, as prove derives the fact that a [0] bounds
|
||||
// failure means the length must have also been 0).
|
||||
// AuxInt contains a report code (see PanicBounds in genericOps.go).
|
||||
{name: "LoweredPanicBoundsRR", argLength: 3, aux: "Int64", reg: regInfo{inputs: []regMask{gp &^ lr, gp &^ lr}}, typ: "Mem", call: true}, // arg0=x, arg1=y, arg2=mem, returns memory.
|
||||
{name: "LoweredPanicBoundsRC", argLength: 2, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{gp &^ lr}}, typ: "Mem", call: true}, // arg0=x, arg1=mem, returns memory.
|
||||
{name: "LoweredPanicBoundsCR", argLength: 2, aux: "PanicBoundsC", reg: regInfo{inputs: []regMask{gp &^ lr}}, typ: "Mem", call: true}, // arg0=y, arg1=mem, returns memory.
|
||||
{name: "LoweredPanicBoundsCC", argLength: 1, aux: "PanicBoundsCC", reg: regInfo{}, typ: "Mem", call: true}, // arg0=mem, returns memory.
|
||||
|
||||
// Constant condition code values. The condition code can be 0, 1, 2 or 3.
|
||||
{name: "FlagEQ"}, // CC=0 (equal)
|
||||
|
|
|
|||
|
|
@ -295,6 +295,10 @@
|
|||
(Neq16 (Const16 <t> [c]) (Add16 (Const16 <t> [d]) x)) => (Neq16 (Const16 <t> [c-d]) x)
|
||||
(Neq8 (Const8 <t> [c]) (Add8 (Const8 <t> [d]) x)) => (Neq8 (Const8 <t> [c-d]) x)
|
||||
|
||||
(CondSelect x _ (ConstBool [true ])) => x
|
||||
(CondSelect _ y (ConstBool [false])) => y
|
||||
(CondSelect x x _) => x
|
||||
|
||||
// signed integer range: ( c <= x && x (<|<=) d ) -> ( unsigned(x-c) (<|<=) unsigned(d-c) )
|
||||
(AndB (Leq64 (Const64 [c]) x) ((Less|Leq)64 x (Const64 [d]))) && d >= c => ((Less|Leq)64U (Sub64 <x.Type> x (Const64 <x.Type> [c])) (Const64 <x.Type> [d-c]))
|
||||
(AndB (Leq32 (Const32 [c]) x) ((Less|Leq)32 x (Const32 [d]))) && d >= c => ((Less|Leq)32U (Sub32 <x.Type> x (Const32 <x.Type> [c])) (Const32 <x.Type> [d-c]))
|
||||
|
|
@ -1010,11 +1014,10 @@
|
|||
// See ../magic.go for a detailed description of these algorithms.
|
||||
|
||||
// Unsigned divide by power of 2. Strength reduce to a shift.
|
||||
(Div8u n (Const8 [c])) && isPowerOfTwo(c) => (Rsh8Ux64 n (Const64 <typ.UInt64> [log8(c)]))
|
||||
(Div16u n (Const16 [c])) && isPowerOfTwo(c) => (Rsh16Ux64 n (Const64 <typ.UInt64> [log16(c)]))
|
||||
(Div32u n (Const32 [c])) && isPowerOfTwo(c) => (Rsh32Ux64 n (Const64 <typ.UInt64> [log32(c)]))
|
||||
(Div64u n (Const64 [c])) && isPowerOfTwo(c) => (Rsh64Ux64 n (Const64 <typ.UInt64> [log64(c)]))
|
||||
(Div64u n (Const64 [-1<<63])) => (Rsh64Ux64 n (Const64 <typ.UInt64> [63]))
|
||||
(Div8u n (Const8 [c])) && isUnsignedPowerOfTwo(uint8(c)) => (Rsh8Ux64 n (Const64 <typ.UInt64> [log8u(uint8(c))]))
|
||||
(Div16u n (Const16 [c])) && isUnsignedPowerOfTwo(uint16(c)) => (Rsh16Ux64 n (Const64 <typ.UInt64> [log16u(uint16(c))]))
|
||||
(Div32u n (Const32 [c])) && isUnsignedPowerOfTwo(uint32(c)) => (Rsh32Ux64 n (Const64 <typ.UInt64> [log32u(uint32(c))]))
|
||||
(Div64u n (Const64 [c])) && isUnsignedPowerOfTwo(uint64(c)) => (Rsh64Ux64 n (Const64 <typ.UInt64> [log64u(uint64(c))]))
|
||||
|
||||
// Signed non-negative divide by power of 2.
|
||||
(Div8 n (Const8 [c])) && isNonNegative(n) && isPowerOfTwo(c) => (Rsh8Ux64 n (Const64 <typ.UInt64> [log8(c)]))
|
||||
|
|
@ -1290,11 +1293,10 @@
|
|||
(Const64 <typ.UInt64> [63])))
|
||||
|
||||
// Unsigned mod by power of 2 constant.
|
||||
(Mod8u <t> n (Const8 [c])) && isPowerOfTwo(c) => (And8 n (Const8 <t> [c-1]))
|
||||
(Mod16u <t> n (Const16 [c])) && isPowerOfTwo(c) => (And16 n (Const16 <t> [c-1]))
|
||||
(Mod32u <t> n (Const32 [c])) && isPowerOfTwo(c) => (And32 n (Const32 <t> [c-1]))
|
||||
(Mod64u <t> n (Const64 [c])) && isPowerOfTwo(c) => (And64 n (Const64 <t> [c-1]))
|
||||
(Mod64u <t> n (Const64 [-1<<63])) => (And64 n (Const64 <t> [1<<63-1]))
|
||||
(Mod8u <t> n (Const8 [c])) && isUnsignedPowerOfTwo(uint8(c)) => (And8 n (Const8 <t> [c-1]))
|
||||
(Mod16u <t> n (Const16 [c])) && isUnsignedPowerOfTwo(uint16(c)) => (And16 n (Const16 <t> [c-1]))
|
||||
(Mod32u <t> n (Const32 [c])) && isUnsignedPowerOfTwo(uint32(c)) => (And32 n (Const32 <t> [c-1]))
|
||||
(Mod64u <t> n (Const64 [c])) && isUnsignedPowerOfTwo(uint64(c)) => (And64 n (Const64 <t> [c-1]))
|
||||
|
||||
// Signed non-negative mod by power of 2 constant.
|
||||
(Mod8 <t> n (Const8 [c])) && isNonNegative(n) && isPowerOfTwo(c) => (And8 n (Const8 <t> [c-1]))
|
||||
|
|
@ -2053,9 +2055,7 @@
|
|||
(Select1 (MakeTuple x y)) => y
|
||||
|
||||
// for rewriting results of some late-expanded rewrites (below)
|
||||
(SelectN [0] (MakeResult x ___)) => x
|
||||
(SelectN [1] (MakeResult x y ___)) => y
|
||||
(SelectN [2] (MakeResult x y z ___)) => z
|
||||
(SelectN [n] m:(MakeResult ___)) => m.Args[n]
|
||||
|
||||
// for late-expanded calls, recognize newobject and remove zeroing and nilchecks
|
||||
(Zero (SelectN [0] call:(StaticLECall _ _)) mem:(SelectN [1] call))
|
||||
|
|
@ -2843,3 +2843,19 @@
|
|||
&& clobber(sbts)
|
||||
&& clobber(key)
|
||||
=> (StaticLECall {f} [argsize] dict_ (StringMake <typ.String> ptr len) mem)
|
||||
|
||||
// Transform some CondSelect into math operations.
|
||||
// if b { x++ } => x += b // but not on arm64 because it has CSINC
|
||||
(CondSelect (Add8 <t> x (Const8 [1])) x bool) && config.arch != "arm64" => (Add8 x (CvtBoolToUint8 <t> bool))
|
||||
(CondSelect (Add(64|32|16) <t> x (Const(64|32|16) [1])) x bool) && config.arch != "arm64" => (Add(64|32|16) x (ZeroExt8to(64|32|16) <t> (CvtBoolToUint8 <types.Types[types.TUINT8]> bool)))
|
||||
|
||||
// if b { x-- } => x -= b
|
||||
(CondSelect (Add8 <t> x (Const8 [-1])) x bool) => (Sub8 x (CvtBoolToUint8 <t> bool))
|
||||
(CondSelect (Add(64|32|16) <t> x (Const(64|32|16) [-1])) x bool) => (Sub(64|32|16) x (ZeroExt8to(64|32|16) <t> (CvtBoolToUint8 <types.Types[types.TUINT8]> bool)))
|
||||
|
||||
// if b { x <<= 1 } => x <<= b
|
||||
(CondSelect (Lsh(64|32|16|8)x64 x (Const64 [1])) x bool) => (Lsh(64|32|16|8)x8 [true] x (CvtBoolToUint8 <types.Types[types.TUINT8]> bool))
|
||||
|
||||
// if b { x >>= 1 } => x >>= b
|
||||
(CondSelect (Rsh(64|32|16|8)x64 x (Const64 [1])) x bool) => (Rsh(64|32|16|8)x8 [true] x (CvtBoolToUint8 <types.Types[types.TUINT8]> bool))
|
||||
(CondSelect (Rsh(64|32|16|8)Ux64 x (Const64 [1])) x bool) => (Rsh(64|32|16|8)Ux8 [true] x (CvtBoolToUint8 <types.Types[types.TUINT8]> bool))
|
||||
|
|
|
|||
|
|
@ -88,6 +88,10 @@ type regInfo struct {
|
|||
// clobbers encodes the set of registers that are overwritten by
|
||||
// the instruction (other than the output registers).
|
||||
clobbers regMask
|
||||
// Instruction clobbers the register containing input 0.
|
||||
clobbersArg0 bool
|
||||
// Instruction clobbers the register containing input 1.
|
||||
clobbersArg1 bool
|
||||
// outputs[i] encodes the set of registers allowed for the i'th output.
|
||||
outputs []regMask
|
||||
}
|
||||
|
|
@ -294,7 +298,7 @@ func genOp() {
|
|||
fmt.Fprintf(w, "argLen: %d,\n", v.argLength)
|
||||
|
||||
if v.rematerializeable {
|
||||
if v.reg.clobbers != 0 {
|
||||
if v.reg.clobbers != 0 || v.reg.clobbersArg0 || v.reg.clobbersArg1 {
|
||||
log.Fatalf("%s is rematerializeable and clobbers registers", v.name)
|
||||
}
|
||||
if v.clobberFlags {
|
||||
|
|
@ -403,6 +407,12 @@ func genOp() {
|
|||
if v.reg.clobbers > 0 {
|
||||
fmt.Fprintf(w, "clobbers: %d,%s\n", v.reg.clobbers, a.regMaskComment(v.reg.clobbers))
|
||||
}
|
||||
if v.reg.clobbersArg0 {
|
||||
fmt.Fprintf(w, "clobbersArg0: true,\n")
|
||||
}
|
||||
if v.reg.clobbersArg1 {
|
||||
fmt.Fprintf(w, "clobbersArg1: true,\n")
|
||||
}
|
||||
|
||||
// reg outputs
|
||||
s = s[:0]
|
||||
|
|
|
|||
|
|
@ -549,6 +549,13 @@ func (u *unusedInspector) node(node ast.Node) {
|
|||
}
|
||||
}
|
||||
case *ast.BasicLit:
|
||||
case *ast.CompositeLit:
|
||||
for _, e := range node.Elts {
|
||||
u.node(e)
|
||||
}
|
||||
case *ast.KeyValueExpr:
|
||||
u.node(node.Key)
|
||||
u.node(node.Value)
|
||||
case *ast.ValueSpec:
|
||||
u.exprs(node.Values)
|
||||
default:
|
||||
|
|
@ -1440,7 +1447,8 @@ func parseValue(val string, arch arch, loc string) (op opData, oparch, typ, auxi
|
|||
func opHasAuxInt(op opData) bool {
|
||||
switch op.aux {
|
||||
case "Bool", "Int8", "Int16", "Int32", "Int64", "Int128", "UInt8", "Float32", "Float64",
|
||||
"SymOff", "CallOff", "SymValAndOff", "TypSize", "ARM64BitField", "FlagConstant", "CCop":
|
||||
"SymOff", "CallOff", "SymValAndOff", "TypSize", "ARM64BitField", "FlagConstant", "CCop",
|
||||
"PanicBoundsC", "PanicBoundsCC":
|
||||
return true
|
||||
}
|
||||
return false
|
||||
|
|
@ -1449,7 +1457,7 @@ func opHasAuxInt(op opData) bool {
|
|||
func opHasAux(op opData) bool {
|
||||
switch op.aux {
|
||||
case "String", "Sym", "SymOff", "Call", "CallOff", "SymValAndOff", "Typ", "TypSize",
|
||||
"S390XCCMask", "S390XRotateParams":
|
||||
"S390XCCMask", "S390XRotateParams", "PanicBoundsC", "PanicBoundsCC":
|
||||
return true
|
||||
}
|
||||
return false
|
||||
|
|
@ -1804,6 +1812,10 @@ func (op opData) auxType() string {
|
|||
return "s390x.CCMask"
|
||||
case "S390XRotateParams":
|
||||
return "s390x.RotateParams"
|
||||
case "PanicBoundsC":
|
||||
return "PanicBoundsC"
|
||||
case "PanicBoundsCC":
|
||||
return "PanicBoundsCC"
|
||||
default:
|
||||
return "invalid"
|
||||
}
|
||||
|
|
@ -1844,6 +1856,8 @@ func (op opData) auxIntType() string {
|
|||
return "flagConstant"
|
||||
case "ARM64BitField":
|
||||
return "arm64BitField"
|
||||
case "PanicBoundsC", "PanicBoundsCC":
|
||||
return "int64"
|
||||
default:
|
||||
return "invalid"
|
||||
}
|
||||
|
|
|
|||
|
|
@ -56,19 +56,23 @@ func (s *biasedSparseMap) contains(x uint) bool {
|
|||
return s.s.contains(ID(int(x) - s.first))
|
||||
}
|
||||
|
||||
// get returns the value s maps for key x, or -1 if
|
||||
// x is not mapped or is out of range for s.
|
||||
func (s *biasedSparseMap) get(x uint) int32 {
|
||||
// get returns the value s maps for key x and true, or
|
||||
// 0/false if x is not mapped or is out of range for s.
|
||||
func (s *biasedSparseMap) get(x uint) (int32, bool) {
|
||||
if s == nil || s.s == nil {
|
||||
return -1
|
||||
return 0, false
|
||||
}
|
||||
if int(x) < s.first {
|
||||
return -1
|
||||
return 0, false
|
||||
}
|
||||
if int(x) >= s.cap() {
|
||||
return -1
|
||||
return 0, false
|
||||
}
|
||||
return s.s.get(ID(int(x) - s.first))
|
||||
k := ID(int(x) - s.first)
|
||||
if !s.s.contains(k) {
|
||||
return 0, false
|
||||
}
|
||||
return s.s.get(k)
|
||||
}
|
||||
|
||||
// getEntry returns the i'th key and value stored in s,
|
||||
|
|
|
|||
|
|
@ -215,6 +215,9 @@ func checkFunc(f *Func) {
|
|||
f.Fatalf("bad FlagConstant AuxInt value for %v", v)
|
||||
}
|
||||
canHaveAuxInt = true
|
||||
case auxPanicBoundsC, auxPanicBoundsCC:
|
||||
canHaveAux = true
|
||||
canHaveAuxInt = true
|
||||
default:
|
||||
f.Fatalf("unknown aux type for %s", v.Op)
|
||||
}
|
||||
|
|
|
|||
|
|
@ -473,11 +473,11 @@ var passes = [...]pass{
|
|||
{name: "expand calls", fn: expandCalls, required: true},
|
||||
{name: "decompose builtin", fn: postExpandCallsDecompose, required: true},
|
||||
{name: "softfloat", fn: softfloat, required: true},
|
||||
{name: "branchelim", fn: branchelim},
|
||||
{name: "late opt", fn: opt, required: true}, // TODO: split required rules and optimizing rules
|
||||
{name: "dead auto elim", fn: elimDeadAutosGeneric},
|
||||
{name: "sccp", fn: sccp},
|
||||
{name: "generic deadcode", fn: deadcode, required: true}, // remove dead stores, which otherwise mess up store chain
|
||||
{name: "branchelim", fn: branchelim},
|
||||
{name: "late fuse", fn: fuseLate},
|
||||
{name: "check bce", fn: checkbce},
|
||||
{name: "dse", fn: dse},
|
||||
|
|
@ -583,6 +583,10 @@ var passOrder = [...]constraint{
|
|||
{"late fuse", "memcombine"},
|
||||
// memcombine is a arch-independent pass.
|
||||
{"memcombine", "lower"},
|
||||
// late opt transform some CondSelects into math.
|
||||
{"branchelim", "late opt"},
|
||||
// ranchelim is an arch-independent pass.
|
||||
{"branchelim", "lower"},
|
||||
}
|
||||
|
||||
func init() {
|
||||
|
|
|
|||
|
|
@ -291,6 +291,8 @@ func NewConfig(arch string, types Types, ctxt *obj.Link, optimize, softfloat boo
|
|||
c.RegSize = 8
|
||||
c.lowerBlock = rewriteBlockLOONG64
|
||||
c.lowerValue = rewriteValueLOONG64
|
||||
c.lateLowerBlock = rewriteBlockLOONG64latelower
|
||||
c.lateLowerValue = rewriteValueLOONG64latelower
|
||||
c.registers = registersLOONG64[:]
|
||||
c.gpRegMask = gpRegMaskLOONG64
|
||||
c.fpRegMask = fpRegMaskLOONG64
|
||||
|
|
@ -570,6 +572,43 @@ func (c *Config) buildRecipes(arch string) {
|
|||
return m.Block.NewValue2I(m.Pos, OpARM64SUBshiftLL, m.Type, int64(i), x, y)
|
||||
})
|
||||
}
|
||||
case "loong64":
|
||||
// - multiply is 4 cycles.
|
||||
// - add/sub/shift are 1 cycle.
|
||||
// On loong64, using a multiply also needs to load the constant into a register.
|
||||
// TODO: figure out a happy medium.
|
||||
mulCost = 45
|
||||
|
||||
// add
|
||||
r(1, 1, 10,
|
||||
func(m, x, y *Value) *Value {
|
||||
return m.Block.NewValue2(m.Pos, OpLOONG64ADDV, m.Type, x, y)
|
||||
})
|
||||
// neg
|
||||
r(-1, 0, 10,
|
||||
func(m, x, y *Value) *Value {
|
||||
return m.Block.NewValue1(m.Pos, OpLOONG64NEGV, m.Type, x)
|
||||
})
|
||||
// sub
|
||||
r(1, -1, 10,
|
||||
func(m, x, y *Value) *Value {
|
||||
return m.Block.NewValue2(m.Pos, OpLOONG64SUBV, m.Type, x, y)
|
||||
})
|
||||
|
||||
// regular shifts
|
||||
for i := 1; i < 64; i++ {
|
||||
c := 10
|
||||
if i == 1 {
|
||||
// Prefer x<<1 over x+x.
|
||||
// Note that we eventually reverse this decision in LOONG64latelower.rules,
|
||||
// but this makes shift combining rules in LOONG64.rules simpler.
|
||||
c--
|
||||
}
|
||||
r(1<<i, 0, c,
|
||||
func(m, x, y *Value) *Value {
|
||||
return m.Block.NewValue1I(m.Pos, OpLOONG64SLLVconst, m.Type, int64(i), x)
|
||||
})
|
||||
}
|
||||
}
|
||||
|
||||
c.mulRecipes = map[int64]mulRecipe{}
|
||||
|
|
@ -636,17 +675,58 @@ func (c *Config) buildRecipes(arch string) {
|
|||
}
|
||||
}
|
||||
|
||||
// Currently we only process 3 linear combination instructions for loong64.
|
||||
if arch == "loong64" {
|
||||
// Three-instruction recipes.
|
||||
// D: The first and the second are all single-instruction recipes, and they are also the third's inputs.
|
||||
// E: The first single-instruction is the second's input, and the second is the third's input.
|
||||
|
||||
// D
|
||||
for _, first := range linearCombos {
|
||||
for _, second := range linearCombos {
|
||||
for _, third := range linearCombos {
|
||||
x := third.a*(first.a+first.b) + third.b*(second.a+second.b)
|
||||
cost := first.cost + second.cost + third.cost
|
||||
old := c.mulRecipes[x]
|
||||
if (old.build == nil || cost < old.cost) && cost < mulCost {
|
||||
c.mulRecipes[x] = mulRecipe{cost: cost, build: func(m, v *Value) *Value {
|
||||
v1 := first.build(m, v, v)
|
||||
v2 := second.build(m, v, v)
|
||||
return third.build(m, v1, v2)
|
||||
}}
|
||||
}
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
// E
|
||||
for _, first := range linearCombos {
|
||||
for _, second := range linearCombos {
|
||||
for _, third := range linearCombos {
|
||||
x := third.a*(second.a*(first.a+first.b)+second.b) + third.b
|
||||
cost := first.cost + second.cost + third.cost
|
||||
old := c.mulRecipes[x]
|
||||
if (old.build == nil || cost < old.cost) && cost < mulCost {
|
||||
c.mulRecipes[x] = mulRecipe{cost: cost, build: func(m, v *Value) *Value {
|
||||
v1 := first.build(m, v, v)
|
||||
v2 := second.build(m, v1, v)
|
||||
return third.build(m, v2, v)
|
||||
}}
|
||||
}
|
||||
}
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
// These cases should be handled specially by rewrite rules.
|
||||
// (Otherwise v * 1 == (neg (neg v)))
|
||||
delete(c.mulRecipes, 0)
|
||||
delete(c.mulRecipes, 1)
|
||||
|
||||
// Currently we assume that it doesn't help to do 3 linear
|
||||
// combination instructions.
|
||||
|
||||
// Currently:
|
||||
// len(c.mulRecipes) == 5984 on arm64
|
||||
// 680 on amd64
|
||||
// 5984 on loong64
|
||||
// This function takes ~2.5ms on arm64.
|
||||
//println(len(c.mulRecipes))
|
||||
}
|
||||
|
|
|
|||
|
|
@ -257,7 +257,7 @@ func deadcode(f *Func) {
|
|||
// Find new homes for lost lines -- require earliest in data flow with same line that is also in same block
|
||||
for i := len(order) - 1; i >= 0; i-- {
|
||||
w := order[i]
|
||||
if j := pendingLines.get(w.Pos); j > -1 && f.Blocks[j] == w.Block {
|
||||
if j, ok := pendingLines.get(w.Pos); ok && f.Blocks[j] == w.Block {
|
||||
w.Pos = w.Pos.WithIsStmt()
|
||||
pendingLines.remove(w.Pos)
|
||||
}
|
||||
|
|
|
|||
|
|
@ -118,7 +118,8 @@ func dse(f *Func) {
|
|||
ptr = la
|
||||
}
|
||||
}
|
||||
sr := shadowRange(shadowed.get(ptr.ID))
|
||||
srNum, _ := shadowed.get(ptr.ID)
|
||||
sr := shadowRange(srNum)
|
||||
if sr.contains(off, off+sz) {
|
||||
// Modify the store/zero into a copy of the memory state,
|
||||
// effectively eliding the store operation.
|
||||
|
|
@ -156,9 +157,7 @@ func dse(f *Func) {
|
|||
|
||||
// A shadowRange encodes a set of byte offsets [lo():hi()] from
|
||||
// a given pointer that will be written to later in the block.
|
||||
// A zero shadowRange encodes an empty shadowed range (and so
|
||||
// does a -1 shadowRange, which is what sparsemap.get returns
|
||||
// on a failed lookup).
|
||||
// A zero shadowRange encodes an empty shadowed range.
|
||||
type shadowRange int32
|
||||
|
||||
func (sr shadowRange) lo() int64 {
|
||||
|
|
|
|||
|
|
@ -41,6 +41,9 @@ type FuncDebug struct {
|
|||
RegOutputParams []*ir.Name
|
||||
// Variable declarations that were removed during optimization
|
||||
OptDcl []*ir.Name
|
||||
// The ssa.Func.EntryID value, used to build location lists for
|
||||
// return values promoted to heap in later DWARF generation.
|
||||
EntryID ID
|
||||
|
||||
// Filled in by the user. Translates Block and Value ID to PC.
|
||||
//
|
||||
|
|
@ -1645,13 +1648,13 @@ func readPtr(ctxt *obj.Link, buf []byte) uint64 {
|
|||
|
||||
}
|
||||
|
||||
// setupLocList creates the initial portion of a location list for a
|
||||
// SetupLocList creates the initial portion of a location list for a
|
||||
// user variable. It emits the encoded start/end of the range and a
|
||||
// placeholder for the size. Return value is the new list plus the
|
||||
// slot in the list holding the size (to be updated later).
|
||||
func setupLocList(ctxt *obj.Link, f *Func, list []byte, st, en ID) ([]byte, int) {
|
||||
start, startOK := encodeValue(ctxt, f.Entry.ID, st)
|
||||
end, endOK := encodeValue(ctxt, f.Entry.ID, en)
|
||||
func SetupLocList(ctxt *obj.Link, entryID ID, list []byte, st, en ID) ([]byte, int) {
|
||||
start, startOK := encodeValue(ctxt, entryID, st)
|
||||
end, endOK := encodeValue(ctxt, entryID, en)
|
||||
if !startOK || !endOK {
|
||||
// This could happen if someone writes a function that uses
|
||||
// >65K values on a 32-bit platform. Hopefully a degraded debugging
|
||||
|
|
@ -1800,7 +1803,6 @@ func isNamedRegParam(p abi.ABIParamAssignment) bool {
|
|||
// appropriate for the ".closureptr" compiler-synthesized variable
|
||||
// needed by the debugger for range func bodies.
|
||||
func BuildFuncDebugNoOptimized(ctxt *obj.Link, f *Func, loggingEnabled bool, stackOffset func(LocalSlot) int32, rval *FuncDebug) {
|
||||
|
||||
needCloCtx := f.CloSlot != nil
|
||||
pri := f.ABISelf.ABIAnalyzeFuncType(f.Type)
|
||||
|
||||
|
|
@ -1911,7 +1913,7 @@ func BuildFuncDebugNoOptimized(ctxt *obj.Link, f *Func, loggingEnabled bool, sta
|
|||
// Param is arriving in one or more registers. We need a 2-element
|
||||
// location expression for it. First entry in location list
|
||||
// will correspond to lifetime in input registers.
|
||||
list, sizeIdx := setupLocList(ctxt, f, rval.LocationLists[pidx],
|
||||
list, sizeIdx := SetupLocList(ctxt, f.Entry.ID, rval.LocationLists[pidx],
|
||||
BlockStart.ID, afterPrologVal)
|
||||
if list == nil {
|
||||
pidx++
|
||||
|
|
@ -1961,7 +1963,7 @@ func BuildFuncDebugNoOptimized(ctxt *obj.Link, f *Func, loggingEnabled bool, sta
|
|||
|
||||
// Second entry in the location list will be the stack home
|
||||
// of the param, once it has been spilled. Emit that now.
|
||||
list, sizeIdx = setupLocList(ctxt, f, list,
|
||||
list, sizeIdx = SetupLocList(ctxt, f.Entry.ID, list,
|
||||
afterPrologVal, FuncEnd.ID)
|
||||
if list == nil {
|
||||
pidx++
|
||||
|
|
|
|||
|
|
@ -115,6 +115,34 @@ func TestDebugLines_53456(t *testing.T) {
|
|||
testDebugLinesDefault(t, "-N -l", "b53456.go", "(*T).Inc", []int{15, 16, 17, 18}, true)
|
||||
}
|
||||
|
||||
func TestDebugLines_74576(t *testing.T) {
|
||||
unixOnly(t)
|
||||
|
||||
switch testGoArch() {
|
||||
default:
|
||||
// Failed on linux/riscv64 (issue 74669), but conservatively
|
||||
// skip many architectures like several other tests here.
|
||||
t.Skip("skipped for many architectures")
|
||||
|
||||
case "arm64", "amd64", "loong64":
|
||||
tests := []struct {
|
||||
file string
|
||||
wantStmts []int
|
||||
}{
|
||||
{"i74576a.go", []int{12, 13, 13, 14}},
|
||||
{"i74576b.go", []int{12, 13, 13, 14}},
|
||||
{"i74576c.go", []int{12, 13, 13, 14}},
|
||||
}
|
||||
t.Parallel()
|
||||
for _, test := range tests {
|
||||
t.Run(test.file, func(t *testing.T) {
|
||||
t.Parallel()
|
||||
testDebugLines(t, "-N -l", test.file, "main", test.wantStmts, false)
|
||||
})
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
func compileAndDump(t *testing.T, file, function, moreGCFlags string) []byte {
|
||||
testenv.MustHaveGoBuild(t)
|
||||
|
||||
|
|
@ -223,6 +251,9 @@ func testInlineStack(t *testing.T, file, function string, wantStacks [][]int) {
|
|||
// then verifies that the statement-marked lines in that file are the same as those in wantStmts
|
||||
// These files must all be short because this is super-fragile.
|
||||
// "go build" is run in a temporary directory that is normally deleted, unless -test.v
|
||||
//
|
||||
// TODO: the tests calling this are somewhat expensive; perhaps more tests can be marked t.Parallel,
|
||||
// or perhaps the mechanism here can be made more efficient.
|
||||
func testDebugLines(t *testing.T, gcflags, file, function string, wantStmts []int, ignoreRepeats bool) {
|
||||
dumpBytes := compileAndDump(t, file, function, gcflags)
|
||||
dump := bufio.NewScanner(bytes.NewReader(dumpBytes))
|
||||
|
|
|
|||
|
|
@ -243,11 +243,8 @@ func (x *expandState) rewriteFuncResults(v *Value, b *Block, aux *AuxCall) {
|
|||
if len(aRegs) > 0 {
|
||||
result = &allResults
|
||||
} else {
|
||||
if a.Op == OpLoad && a.Args[0].Op == OpLocalAddr {
|
||||
addr := a.Args[0]
|
||||
if addr.MemoryArg() == a.MemoryArg() && addr.Aux == aux.NameOfResult(i) {
|
||||
continue // Self move to output parameter
|
||||
}
|
||||
if a.Op == OpLoad && a.Args[0].Op == OpLocalAddr && a.Args[0].Aux == aux.NameOfResult(i) {
|
||||
continue // Self move to output parameter
|
||||
}
|
||||
}
|
||||
rc.init(aRegs, aux.abiInfo, result, auxBase, auxOffset)
|
||||
|
|
|
|||
|
|
@ -12,18 +12,15 @@ type loop struct {
|
|||
header *Block // The header node of this (reducible) loop
|
||||
outer *loop // loop containing this loop
|
||||
|
||||
// By default, children, exits, and depth are not initialized.
|
||||
children []*loop // loops nested directly within this loop. Initialized by assembleChildren().
|
||||
exits []*Block // exits records blocks reached by exits from this loop. Initialized by findExits().
|
||||
|
||||
// Next three fields used by regalloc and/or
|
||||
// aid in computation of inner-ness and list of blocks.
|
||||
nBlocks int32 // Number of blocks in this loop but not within inner loops
|
||||
depth int16 // Nesting depth of the loop; 1 is outermost. Initialized by calculateDepths().
|
||||
depth int16 // Nesting depth of the loop; 1 is outermost.
|
||||
isInner bool // True if never discovered to contain a loop
|
||||
|
||||
// register allocation uses this.
|
||||
containsUnavoidableCall bool // True if all paths through the loop have a call
|
||||
// True if all paths through the loop have a call.
|
||||
// Computed and used by regalloc; stored here for convenience.
|
||||
containsUnavoidableCall bool
|
||||
}
|
||||
|
||||
// outerinner records that outer contains inner
|
||||
|
|
@ -49,18 +46,6 @@ func (sdom SparseTree) outerinner(outer, inner *loop) {
|
|||
outer.isInner = false
|
||||
}
|
||||
|
||||
func checkContainsCall(bb *Block) bool {
|
||||
if bb.Kind == BlockDefer {
|
||||
return true
|
||||
}
|
||||
for _, v := range bb.Values {
|
||||
if opcodeTable[v.Op].call {
|
||||
return true
|
||||
}
|
||||
}
|
||||
return false
|
||||
}
|
||||
|
||||
type loopnest struct {
|
||||
f *Func
|
||||
b2l []*loop
|
||||
|
|
@ -68,9 +53,6 @@ type loopnest struct {
|
|||
sdom SparseTree
|
||||
loops []*loop
|
||||
hasIrreducible bool // TODO current treatment of irreducible loops is very flaky, if accurate loops are needed, must punt at function level.
|
||||
|
||||
// Record which of the lazily initialized fields have actually been initialized.
|
||||
initializedChildren, initializedDepth, initializedExits bool
|
||||
}
|
||||
|
||||
const (
|
||||
|
|
@ -355,91 +337,59 @@ func loopnestfor(f *Func) *loopnest {
|
|||
visited[b.ID] = true
|
||||
}
|
||||
|
||||
ln := &loopnest{f: f, b2l: b2l, po: po, sdom: sdom, loops: loops, hasIrreducible: sawIrred}
|
||||
|
||||
// Calculate containsUnavoidableCall for regalloc
|
||||
dominatedByCall := f.Cache.allocBoolSlice(f.NumBlocks())
|
||||
defer f.Cache.freeBoolSlice(dominatedByCall)
|
||||
for _, b := range po {
|
||||
if checkContainsCall(b) {
|
||||
dominatedByCall[b.ID] = true
|
||||
}
|
||||
}
|
||||
// Run dfs to find path through the loop that avoids all calls.
|
||||
// Such path either escapes loop or return back to header.
|
||||
// It isn't enough to have exit not dominated by any call, for example:
|
||||
// ... some loop
|
||||
// call1 call2
|
||||
// \ /
|
||||
// exit
|
||||
// ...
|
||||
// exit is not dominated by any call, but we don't have call-free path to it.
|
||||
// Compute depths.
|
||||
for _, l := range loops {
|
||||
// Header contains call.
|
||||
if dominatedByCall[l.header.ID] {
|
||||
l.containsUnavoidableCall = true
|
||||
if l.depth != 0 {
|
||||
// Already computed because it is an ancestor of
|
||||
// a previous loop.
|
||||
continue
|
||||
}
|
||||
callfreepath := false
|
||||
tovisit := make([]*Block, 0, len(l.header.Succs))
|
||||
// Push all non-loop non-exit successors of header onto toVisit.
|
||||
for _, s := range l.header.Succs {
|
||||
nb := s.Block()
|
||||
// This corresponds to loop with zero iterations.
|
||||
if !l.iterationEnd(nb, b2l) {
|
||||
tovisit = append(tovisit, nb)
|
||||
}
|
||||
}
|
||||
for len(tovisit) > 0 {
|
||||
cur := tovisit[len(tovisit)-1]
|
||||
tovisit = tovisit[:len(tovisit)-1]
|
||||
if dominatedByCall[cur.ID] {
|
||||
continue
|
||||
}
|
||||
// Record visited in dominatedByCall.
|
||||
dominatedByCall[cur.ID] = true
|
||||
for _, s := range cur.Succs {
|
||||
nb := s.Block()
|
||||
if l.iterationEnd(nb, b2l) {
|
||||
callfreepath = true
|
||||
}
|
||||
if !dominatedByCall[nb.ID] {
|
||||
tovisit = append(tovisit, nb)
|
||||
}
|
||||
|
||||
}
|
||||
if callfreepath {
|
||||
// Find depth by walking up the loop tree.
|
||||
d := int16(0)
|
||||
for x := l; x != nil; x = x.outer {
|
||||
if x.depth != 0 {
|
||||
d += x.depth
|
||||
break
|
||||
}
|
||||
d++
|
||||
}
|
||||
if !callfreepath {
|
||||
l.containsUnavoidableCall = true
|
||||
// Set depth for every ancestor.
|
||||
for x := l; x != nil; x = x.outer {
|
||||
if x.depth != 0 {
|
||||
break
|
||||
}
|
||||
x.depth = d
|
||||
d--
|
||||
}
|
||||
}
|
||||
// Double-check depths.
|
||||
for _, l := range loops {
|
||||
want := int16(1)
|
||||
if l.outer != nil {
|
||||
want = l.outer.depth + 1
|
||||
}
|
||||
if l.depth != want {
|
||||
l.header.Fatalf("bad depth calculation for loop %s: got %d want %d", l.header, l.depth, want)
|
||||
}
|
||||
}
|
||||
|
||||
ln := &loopnest{f: f, b2l: b2l, po: po, sdom: sdom, loops: loops, hasIrreducible: sawIrred}
|
||||
|
||||
// Curious about the loopiness? "-d=ssa/likelyadjust/stats"
|
||||
if f.pass != nil && f.pass.stats > 0 && len(loops) > 0 {
|
||||
ln.assembleChildren()
|
||||
ln.calculateDepths()
|
||||
ln.findExits()
|
||||
|
||||
// Note stats for non-innermost loops are slightly flawed because
|
||||
// they don't account for inner loop exits that span multiple levels.
|
||||
|
||||
for _, l := range loops {
|
||||
x := len(l.exits)
|
||||
cf := 0
|
||||
if !l.containsUnavoidableCall {
|
||||
cf = 1
|
||||
}
|
||||
inner := 0
|
||||
if l.isInner {
|
||||
inner++
|
||||
}
|
||||
|
||||
f.LogStat("loopstats:",
|
||||
l.depth, "depth", x, "exits",
|
||||
inner, "is_inner", cf, "always_calls", l.nBlocks, "n_blocks")
|
||||
f.LogStat("loopstats in "+f.Name+":",
|
||||
l.depth, "depth",
|
||||
inner, "is_inner", l.nBlocks, "n_blocks")
|
||||
}
|
||||
}
|
||||
|
||||
|
|
@ -465,62 +415,6 @@ func loopnestfor(f *Func) *loopnest {
|
|||
return ln
|
||||
}
|
||||
|
||||
// assembleChildren initializes the children field of each
|
||||
// loop in the nest. Loop A is a child of loop B if A is
|
||||
// directly nested within B (based on the reducible-loops
|
||||
// detection above)
|
||||
func (ln *loopnest) assembleChildren() {
|
||||
if ln.initializedChildren {
|
||||
return
|
||||
}
|
||||
for _, l := range ln.loops {
|
||||
if l.outer != nil {
|
||||
l.outer.children = append(l.outer.children, l)
|
||||
}
|
||||
}
|
||||
ln.initializedChildren = true
|
||||
}
|
||||
|
||||
// calculateDepths uses the children field of loops
|
||||
// to determine the nesting depth (outer=1) of each
|
||||
// loop. This is helpful for finding exit edges.
|
||||
func (ln *loopnest) calculateDepths() {
|
||||
if ln.initializedDepth {
|
||||
return
|
||||
}
|
||||
ln.assembleChildren()
|
||||
for _, l := range ln.loops {
|
||||
if l.outer == nil {
|
||||
l.setDepth(1)
|
||||
}
|
||||
}
|
||||
ln.initializedDepth = true
|
||||
}
|
||||
|
||||
// findExits uses loop depth information to find the
|
||||
// exits from a loop.
|
||||
func (ln *loopnest) findExits() {
|
||||
if ln.initializedExits {
|
||||
return
|
||||
}
|
||||
ln.calculateDepths()
|
||||
b2l := ln.b2l
|
||||
for _, b := range ln.po {
|
||||
l := b2l[b.ID]
|
||||
if l != nil && len(b.Succs) == 2 {
|
||||
sl := b2l[b.Succs[0].b.ID]
|
||||
if recordIfExit(l, sl, b.Succs[0].b) {
|
||||
continue
|
||||
}
|
||||
sl = b2l[b.Succs[1].b.ID]
|
||||
if recordIfExit(l, sl, b.Succs[1].b) {
|
||||
continue
|
||||
}
|
||||
}
|
||||
}
|
||||
ln.initializedExits = true
|
||||
}
|
||||
|
||||
// depth returns the loop nesting level of block b.
|
||||
func (ln *loopnest) depth(b ID) int16 {
|
||||
if l := ln.b2l[b]; l != nil {
|
||||
|
|
@ -528,39 +422,3 @@ func (ln *loopnest) depth(b ID) int16 {
|
|||
}
|
||||
return 0
|
||||
}
|
||||
|
||||
// recordIfExit checks sl (the loop containing b) to see if it
|
||||
// is outside of loop l, and if so, records b as an exit block
|
||||
// from l and returns true.
|
||||
func recordIfExit(l, sl *loop, b *Block) bool {
|
||||
if sl != l {
|
||||
if sl == nil || sl.depth <= l.depth {
|
||||
l.exits = append(l.exits, b)
|
||||
return true
|
||||
}
|
||||
// sl is not nil, and is deeper than l
|
||||
// it's possible for this to be a goto into an irreducible loop made from gotos.
|
||||
for sl.depth > l.depth {
|
||||
sl = sl.outer
|
||||
}
|
||||
if sl != l {
|
||||
l.exits = append(l.exits, b)
|
||||
return true
|
||||
}
|
||||
}
|
||||
return false
|
||||
}
|
||||
|
||||
func (l *loop) setDepth(d int16) {
|
||||
l.depth = d
|
||||
for _, c := range l.children {
|
||||
c.setDepth(d + 1)
|
||||
}
|
||||
}
|
||||
|
||||
// iterationEnd checks if block b ends iteration of loop l.
|
||||
// Ending iteration means either escaping to outer loop/code or
|
||||
// going back to header
|
||||
func (l *loop) iterationEnd(b *Block, b2l []*loop) bool {
|
||||
return b == l.header || b2l[b.ID] == nil || (b2l[b.ID] != l && b2l[b.ID].depth <= l.depth)
|
||||
}
|
||||
|
|
|
|||
|
|
@ -37,19 +37,20 @@ type indVar struct {
|
|||
// - the minimum bound
|
||||
// - the increment value
|
||||
// - the "next" value (SSA value that is Phi'd into the induction variable every loop)
|
||||
// - the header's edge returning from the body
|
||||
//
|
||||
// Currently, we detect induction variables that match (Phi min nxt),
|
||||
// with nxt being (Add inc ind).
|
||||
// If it can't parse the induction variable correctly, it returns (nil, nil, nil).
|
||||
func parseIndVar(ind *Value) (min, inc, nxt *Value) {
|
||||
func parseIndVar(ind *Value) (min, inc, nxt *Value, loopReturn Edge) {
|
||||
if ind.Op != OpPhi {
|
||||
return
|
||||
}
|
||||
|
||||
if n := ind.Args[0]; (n.Op == OpAdd64 || n.Op == OpAdd32 || n.Op == OpAdd16 || n.Op == OpAdd8) && (n.Args[0] == ind || n.Args[1] == ind) {
|
||||
min, nxt = ind.Args[1], n
|
||||
min, nxt, loopReturn = ind.Args[1], n, ind.Block.Preds[0]
|
||||
} else if n := ind.Args[1]; (n.Op == OpAdd64 || n.Op == OpAdd32 || n.Op == OpAdd16 || n.Op == OpAdd8) && (n.Args[0] == ind || n.Args[1] == ind) {
|
||||
min, nxt = ind.Args[0], n
|
||||
min, nxt, loopReturn = ind.Args[0], n, ind.Block.Preds[1]
|
||||
} else {
|
||||
// Not a recognized induction variable.
|
||||
return
|
||||
|
|
@ -111,13 +112,13 @@ func findIndVar(f *Func) []indVar {
|
|||
|
||||
// See if this is really an induction variable
|
||||
less := true
|
||||
init, inc, nxt := parseIndVar(ind)
|
||||
init, inc, nxt, loopReturn := parseIndVar(ind)
|
||||
if init == nil {
|
||||
// We failed to parse the induction variable. Before punting, we want to check
|
||||
// whether the control op was written with the induction variable on the RHS
|
||||
// instead of the LHS. This happens for the downwards case, like:
|
||||
// for i := len(n)-1; i >= 0; i--
|
||||
init, inc, nxt = parseIndVar(limit)
|
||||
init, inc, nxt, loopReturn = parseIndVar(limit)
|
||||
if init == nil {
|
||||
// No recognized induction variable on either operand
|
||||
continue
|
||||
|
|
@ -145,6 +146,20 @@ func findIndVar(f *Func) []indVar {
|
|||
continue
|
||||
}
|
||||
|
||||
// startBody is the edge that eventually returns to the loop header.
|
||||
var startBody Edge
|
||||
switch {
|
||||
case sdom.IsAncestorEq(b.Succs[0].b, loopReturn.b):
|
||||
startBody = b.Succs[0]
|
||||
case sdom.IsAncestorEq(b.Succs[1].b, loopReturn.b):
|
||||
// if x { goto exit } else { goto entry } is identical to if !x { goto entry } else { goto exit }
|
||||
startBody = b.Succs[1]
|
||||
less = !less
|
||||
inclusive = !inclusive
|
||||
default:
|
||||
continue
|
||||
}
|
||||
|
||||
// Increment sign must match comparison direction.
|
||||
// When incrementing, the termination comparison must be ind </<= limit.
|
||||
// When decrementing, the termination comparison must be ind >/>= limit.
|
||||
|
|
@ -172,14 +187,14 @@ func findIndVar(f *Func) []indVar {
|
|||
// First condition: loop entry has a single predecessor, which
|
||||
// is the header block. This implies that b.Succs[0] is
|
||||
// reached iff ind < limit.
|
||||
if len(b.Succs[0].b.Preds) != 1 {
|
||||
// b.Succs[1] must exit the loop.
|
||||
if len(startBody.b.Preds) != 1 {
|
||||
// the other successor must exit the loop.
|
||||
continue
|
||||
}
|
||||
|
||||
// Second condition: b.Succs[0] dominates nxt so that
|
||||
// Second condition: startBody.b dominates nxt so that
|
||||
// nxt is computed when inc < limit.
|
||||
if !sdom.IsAncestorEq(b.Succs[0].b, nxt.Block) {
|
||||
if !sdom.IsAncestorEq(startBody.b, nxt.Block) {
|
||||
// inc+ind can only be reached through the branch that enters the loop.
|
||||
continue
|
||||
}
|
||||
|
|
@ -298,7 +313,7 @@ func findIndVar(f *Func) []indVar {
|
|||
nxt: nxt,
|
||||
min: min,
|
||||
max: max,
|
||||
entry: b.Succs[0].b,
|
||||
entry: startBody.b,
|
||||
flags: flags,
|
||||
})
|
||||
b.Logf("found induction variable %v (inc = %v, min = %v, max = %v)\n", ind, inc, min, max)
|
||||
|
|
|
|||
|
|
@ -4,6 +4,10 @@
|
|||
|
||||
package ssa
|
||||
|
||||
import (
|
||||
"slices"
|
||||
)
|
||||
|
||||
// loopRotate converts loops with a check-loop-condition-at-beginning
|
||||
// to loops with a check-loop-condition-at-end.
|
||||
// This helps loops avoid extra unnecessary jumps.
|
||||
|
|
@ -41,10 +45,64 @@ func loopRotate(f *Func) {
|
|||
|
||||
// Map from block ID to the moving blocks that should
|
||||
// come right after it.
|
||||
// If a block, which has its ID present in keys of the 'after' map,
|
||||
// occurs in some other block's 'after' list, that represents whole
|
||||
// nested loop, e.g. consider an inner loop I nested into an outer
|
||||
// loop O. It and Ot are corresponding top block for these loops
|
||||
// chosen by our algorithm, and It is in the Ot's 'after' list.
|
||||
//
|
||||
// Before: After:
|
||||
//
|
||||
// e e
|
||||
// │ │
|
||||
// │ │Ot ◄───┐
|
||||
// ▼ ▼▼ │
|
||||
// ┌───Oh ◄────┐ ┌─┬─Oh │
|
||||
// │ │ │ │ │ │
|
||||
// │ │ │ │ │ It◄───┐ │
|
||||
// │ ▼ │ │ │ ▼ │ │
|
||||
// │ ┌─Ih◄───┐ │ │ └►Ih │ │
|
||||
// │ │ │ │ │ │ ┌─┤ │ │
|
||||
// │ │ ▼ │ │ │ │ ▼ │ │
|
||||
// │ │ Ib │ │ │ │ Ib │ │
|
||||
// │ │ └─►It─┘ │ │ │ └─────┘ │
|
||||
// │ │ │ │ │ │
|
||||
// │ └►Ie │ │ └►Ie │
|
||||
// │ └─►Ot───┘ │ └───────┘
|
||||
// │ │
|
||||
// └──►Oe └──►Oe
|
||||
//
|
||||
// We build the 'after' lists for each of the top blocks Ot and It:
|
||||
// after[Ot]: Oh, It, Ie
|
||||
// after[It]: Ih, Ib
|
||||
after := map[ID][]*Block{}
|
||||
|
||||
// Map from loop header ID to the new top block for the loop.
|
||||
tops := map[ID]*Block{}
|
||||
|
||||
// Order loops to rotate any child loop before adding its top block
|
||||
// to the parent loop's 'after' list.
|
||||
loopOrder := f.Cache.allocIntSlice(len(loopnest.loops))
|
||||
for i := range loopOrder {
|
||||
loopOrder[i] = i
|
||||
}
|
||||
defer f.Cache.freeIntSlice(loopOrder)
|
||||
slices.SortFunc(loopOrder, func(i, j int) int {
|
||||
di := loopnest.loops[i].depth
|
||||
dj := loopnest.loops[j].depth
|
||||
switch {
|
||||
case di > dj:
|
||||
return -1
|
||||
case di < dj:
|
||||
return 1
|
||||
default:
|
||||
return 0
|
||||
}
|
||||
})
|
||||
|
||||
// Check each loop header and decide if we want to move it.
|
||||
for _, loop := range loopnest.loops {
|
||||
for _, loopIdx := range loopOrder {
|
||||
loop := loopnest.loops[loopIdx]
|
||||
b := loop.header
|
||||
var p *Block // b's in-loop predecessor
|
||||
for _, e := range b.Preds {
|
||||
|
|
@ -59,6 +117,7 @@ func loopRotate(f *Func) {
|
|||
if p == nil {
|
||||
continue
|
||||
}
|
||||
tops[loop.header.ID] = p
|
||||
p.Hotness |= HotInitial
|
||||
if f.IsPgoHot {
|
||||
p.Hotness |= HotPgo
|
||||
|
|
@ -80,8 +139,10 @@ func loopRotate(f *Func) {
|
|||
if nextb == p { // original loop predecessor is next
|
||||
break
|
||||
}
|
||||
if loopnest.b2l[nextb.ID] == loop {
|
||||
after[p.ID] = append(after[p.ID], nextb)
|
||||
if bloop := loopnest.b2l[nextb.ID]; bloop != nil {
|
||||
if bloop == loop || bloop.outer == loop && tops[bloop.header.ID] == nextb {
|
||||
after[p.ID] = append(after[p.ID], nextb)
|
||||
}
|
||||
}
|
||||
b = nextb
|
||||
}
|
||||
|
|
@ -90,7 +151,7 @@ func loopRotate(f *Func) {
|
|||
f.Blocks[idToIdx[p.ID]] = loop.header
|
||||
idToIdx[loop.header.ID], idToIdx[p.ID] = idToIdx[p.ID], idToIdx[loop.header.ID]
|
||||
|
||||
// Place b after p.
|
||||
// Place loop blocks after p.
|
||||
for _, b := range after[p.ID] {
|
||||
move[b.ID] = struct{}{}
|
||||
}
|
||||
|
|
@ -107,16 +168,23 @@ func loopRotate(f *Func) {
|
|||
oldOrder := f.Cache.allocBlockSlice(len(f.Blocks))
|
||||
defer f.Cache.freeBlockSlice(oldOrder)
|
||||
copy(oldOrder, f.Blocks)
|
||||
var moveBlocks func(bs []*Block)
|
||||
moveBlocks = func(blocks []*Block) {
|
||||
for _, a := range blocks {
|
||||
f.Blocks[j] = a
|
||||
j++
|
||||
if nextBlocks, ok := after[a.ID]; ok {
|
||||
moveBlocks(nextBlocks)
|
||||
}
|
||||
}
|
||||
}
|
||||
for _, b := range oldOrder {
|
||||
if _, ok := move[b.ID]; ok {
|
||||
continue
|
||||
}
|
||||
f.Blocks[j] = b
|
||||
j++
|
||||
for _, a := range after[b.ID] {
|
||||
f.Blocks[j] = a
|
||||
j++
|
||||
}
|
||||
moveBlocks(after[b.ID])
|
||||
}
|
||||
if j != len(oldOrder) {
|
||||
f.Fatalf("bad reordering in looprotate")
|
||||
|
|
|
|||
65
src/cmd/compile/internal/ssa/looprotate_test.go
Normal file
65
src/cmd/compile/internal/ssa/looprotate_test.go
Normal file
|
|
@ -0,0 +1,65 @@
|
|||
// Copyright 2025 The Go Authors. All rights reserved.
|
||||
// Use of this source code is governed by a BSD-style
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
package ssa
|
||||
|
||||
import (
|
||||
"cmd/compile/internal/types"
|
||||
"testing"
|
||||
)
|
||||
|
||||
func TestLoopRotateNested(t *testing.T) {
|
||||
c := testConfig(t)
|
||||
fun := c.Fun("entry",
|
||||
Bloc("entry",
|
||||
Valu("mem", OpInitMem, types.TypeMem, 0, nil),
|
||||
Valu("constTrue", OpConstBool, types.Types[types.TBOOL], 1, nil),
|
||||
Goto("outerHeader")),
|
||||
Bloc("outerHeader",
|
||||
If("constTrue", "outerBody", "outerExit")),
|
||||
Bloc("outerBody",
|
||||
Goto("innerHeader")),
|
||||
Bloc("innerHeader",
|
||||
If("constTrue", "innerBody", "innerExit")),
|
||||
Bloc("innerBody",
|
||||
Goto("innerTop")),
|
||||
Bloc("innerTop",
|
||||
Goto("innerHeader")),
|
||||
Bloc("innerExit",
|
||||
Goto("outerTop")),
|
||||
Bloc("outerTop",
|
||||
Goto("outerHeader")),
|
||||
Bloc("outerExit",
|
||||
Exit("mem")))
|
||||
|
||||
blockName := make([]string, len(fun.f.Blocks)+1)
|
||||
for name, block := range fun.blocks {
|
||||
blockName[block.ID] = name
|
||||
}
|
||||
|
||||
CheckFunc(fun.f)
|
||||
loopRotate(fun.f)
|
||||
CheckFunc(fun.f)
|
||||
|
||||
// Verify the resulting block order
|
||||
expected := []string{
|
||||
"entry",
|
||||
"outerTop",
|
||||
"outerHeader",
|
||||
"outerBody",
|
||||
"innerTop",
|
||||
"innerHeader",
|
||||
"innerBody",
|
||||
"innerExit",
|
||||
"outerExit",
|
||||
}
|
||||
if len(expected) != len(fun.f.Blocks) {
|
||||
t.Fatalf("expected %d blocks, found %d", len(expected), len(fun.f.Blocks))
|
||||
}
|
||||
for i, b := range fun.f.Blocks {
|
||||
if expected[i] != blockName[b.ID] {
|
||||
t.Errorf("position %d: expected %s, found %s", i, expected[i], blockName[b.ID])
|
||||
}
|
||||
}
|
||||
}
|
||||
|
|
@ -221,7 +221,8 @@ func nilcheckelim2(f *Func) {
|
|||
|
||||
// Iteration order means that first nilcheck in the chain wins, others
|
||||
// are bumped into the ordinary statement preservation algorithm.
|
||||
u := b.Values[unnecessary.get(v.Args[0].ID)]
|
||||
uid, _ := unnecessary.get(v.Args[0].ID)
|
||||
u := b.Values[uid]
|
||||
if !u.Type.IsMemory() && !u.Pos.SameFileAndLine(v.Pos) {
|
||||
if u.Pos.IsStmt() == src.PosIsStmt {
|
||||
pendingLines.add(u.Pos)
|
||||
|
|
|
|||
|
|
@ -6,10 +6,12 @@ package ssa
|
|||
|
||||
import (
|
||||
"cmd/compile/internal/abi"
|
||||
"cmd/compile/internal/base"
|
||||
"cmd/compile/internal/ir"
|
||||
"cmd/compile/internal/types"
|
||||
"cmd/internal/obj"
|
||||
"fmt"
|
||||
rtabi "internal/abi"
|
||||
"strings"
|
||||
)
|
||||
|
||||
|
|
@ -68,6 +70,10 @@ type regInfo struct {
|
|||
// clobbers encodes the set of registers that are overwritten by
|
||||
// the instruction (other than the output registers).
|
||||
clobbers regMask
|
||||
// Instruction clobbers the register containing input 0.
|
||||
clobbersArg0 bool
|
||||
// Instruction clobbers the register containing input 1.
|
||||
clobbersArg1 bool
|
||||
// outputs is the same as inputs, but for the outputs of the instruction.
|
||||
outputs []outputInfo
|
||||
}
|
||||
|
|
@ -365,6 +371,9 @@ const (
|
|||
auxCall // aux is a *ssa.AuxCall
|
||||
auxCallOff // aux is a *ssa.AuxCall, AuxInt is int64 param (in+out) size
|
||||
|
||||
auxPanicBoundsC // constant for a bounds failure
|
||||
auxPanicBoundsCC // two constants for a bounds failure
|
||||
|
||||
// architecture specific aux types
|
||||
auxARM64BitField // aux is an arm64 bitfield lsb and width packed into auxInt
|
||||
auxS390XRotateParams // aux is a s390x rotate parameters object encoding start bit, end bit and rotate amount
|
||||
|
|
@ -523,6 +532,50 @@ func boundsABI(b int64) int {
|
|||
}
|
||||
}
|
||||
|
||||
// Returns the bounds error code needed by the runtime, and
|
||||
// whether the x field is signed.
|
||||
func (b BoundsKind) Code() (rtabi.BoundsErrorCode, bool) {
|
||||
switch b {
|
||||
case BoundsIndex:
|
||||
return rtabi.BoundsIndex, true
|
||||
case BoundsIndexU:
|
||||
return rtabi.BoundsIndex, false
|
||||
case BoundsSliceAlen:
|
||||
return rtabi.BoundsSliceAlen, true
|
||||
case BoundsSliceAlenU:
|
||||
return rtabi.BoundsSliceAlen, false
|
||||
case BoundsSliceAcap:
|
||||
return rtabi.BoundsSliceAcap, true
|
||||
case BoundsSliceAcapU:
|
||||
return rtabi.BoundsSliceAcap, false
|
||||
case BoundsSliceB:
|
||||
return rtabi.BoundsSliceB, true
|
||||
case BoundsSliceBU:
|
||||
return rtabi.BoundsSliceB, false
|
||||
case BoundsSlice3Alen:
|
||||
return rtabi.BoundsSlice3Alen, true
|
||||
case BoundsSlice3AlenU:
|
||||
return rtabi.BoundsSlice3Alen, false
|
||||
case BoundsSlice3Acap:
|
||||
return rtabi.BoundsSlice3Acap, true
|
||||
case BoundsSlice3AcapU:
|
||||
return rtabi.BoundsSlice3Acap, false
|
||||
case BoundsSlice3B:
|
||||
return rtabi.BoundsSlice3B, true
|
||||
case BoundsSlice3BU:
|
||||
return rtabi.BoundsSlice3B, false
|
||||
case BoundsSlice3C:
|
||||
return rtabi.BoundsSlice3C, true
|
||||
case BoundsSlice3CU:
|
||||
return rtabi.BoundsSlice3C, false
|
||||
case BoundsConvert:
|
||||
return rtabi.BoundsConvert, false
|
||||
default:
|
||||
base.Fatalf("bad bounds kind %d", b)
|
||||
return 0, false
|
||||
}
|
||||
}
|
||||
|
||||
// arm64BitField is the GO type of ARM64BitField auxInt.
|
||||
// if x is an ARM64BitField, then width=x&0xff, lsb=(x>>8)&0xff, and
|
||||
// width+lsb<64 for 64-bit variant, width+lsb<32 for 32-bit variant.
|
||||
|
|
|
|||
|
|
@ -569,12 +569,12 @@ const (
|
|||
Op386LoweredGetCallerSP
|
||||
Op386LoweredNilCheck
|
||||
Op386LoweredWB
|
||||
Op386LoweredPanicBoundsA
|
||||
Op386LoweredPanicBoundsB
|
||||
Op386LoweredPanicBoundsC
|
||||
Op386LoweredPanicExtendA
|
||||
Op386LoweredPanicExtendB
|
||||
Op386LoweredPanicExtendC
|
||||
Op386LoweredPanicBoundsRR
|
||||
Op386LoweredPanicBoundsRC
|
||||
Op386LoweredPanicBoundsCR
|
||||
Op386LoweredPanicBoundsCC
|
||||
Op386LoweredPanicExtendRR
|
||||
Op386LoweredPanicExtendRC
|
||||
Op386FlagEQ
|
||||
Op386FlagLT_ULT
|
||||
Op386FlagLT_UGT
|
||||
|
|
@ -1051,7 +1051,8 @@ const (
|
|||
OpAMD64MOVLstoreconstidx4
|
||||
OpAMD64MOVQstoreconstidx1
|
||||
OpAMD64MOVQstoreconstidx8
|
||||
OpAMD64DUFFZERO
|
||||
OpAMD64LoweredZero
|
||||
OpAMD64LoweredZeroLoop
|
||||
OpAMD64REPSTOSQ
|
||||
OpAMD64CALLstatic
|
||||
OpAMD64CALLtail
|
||||
|
|
@ -1067,9 +1068,10 @@ const (
|
|||
OpAMD64LoweredNilCheck
|
||||
OpAMD64LoweredWB
|
||||
OpAMD64LoweredHasCPUFeature
|
||||
OpAMD64LoweredPanicBoundsA
|
||||
OpAMD64LoweredPanicBoundsB
|
||||
OpAMD64LoweredPanicBoundsC
|
||||
OpAMD64LoweredPanicBoundsRR
|
||||
OpAMD64LoweredPanicBoundsRC
|
||||
OpAMD64LoweredPanicBoundsCR
|
||||
OpAMD64LoweredPanicBoundsCC
|
||||
OpAMD64FlagEQ
|
||||
OpAMD64FlagLT_ULT
|
||||
OpAMD64FlagLT_UGT
|
||||
|
|
@ -2478,12 +2480,12 @@ const (
|
|||
OpARMLoweredGetClosurePtr
|
||||
OpARMLoweredGetCallerSP
|
||||
OpARMLoweredGetCallerPC
|
||||
OpARMLoweredPanicBoundsA
|
||||
OpARMLoweredPanicBoundsB
|
||||
OpARMLoweredPanicBoundsC
|
||||
OpARMLoweredPanicExtendA
|
||||
OpARMLoweredPanicExtendB
|
||||
OpARMLoweredPanicExtendC
|
||||
OpARMLoweredPanicBoundsRR
|
||||
OpARMLoweredPanicBoundsRC
|
||||
OpARMLoweredPanicBoundsCR
|
||||
OpARMLoweredPanicBoundsCC
|
||||
OpARMLoweredPanicExtendRR
|
||||
OpARMLoweredPanicExtendRC
|
||||
OpARMFlagConstant
|
||||
OpARMInvertFlags
|
||||
OpARMLoweredWB
|
||||
|
|
@ -2814,9 +2816,10 @@ const (
|
|||
OpARM64LoweredAtomicAnd32Variant
|
||||
OpARM64LoweredAtomicOr32Variant
|
||||
OpARM64LoweredWB
|
||||
OpARM64LoweredPanicBoundsA
|
||||
OpARM64LoweredPanicBoundsB
|
||||
OpARM64LoweredPanicBoundsC
|
||||
OpARM64LoweredPanicBoundsRR
|
||||
OpARM64LoweredPanicBoundsRC
|
||||
OpARM64LoweredPanicBoundsCR
|
||||
OpARM64LoweredPanicBoundsCC
|
||||
OpARM64PRFM
|
||||
OpARM64DMB
|
||||
OpARM64ZERO
|
||||
|
|
@ -3018,9 +3021,10 @@ const (
|
|||
OpLOONG64LoweredGetCallerPC
|
||||
OpLOONG64LoweredWB
|
||||
OpLOONG64LoweredPubBarrier
|
||||
OpLOONG64LoweredPanicBoundsA
|
||||
OpLOONG64LoweredPanicBoundsB
|
||||
OpLOONG64LoweredPanicBoundsC
|
||||
OpLOONG64LoweredPanicBoundsRR
|
||||
OpLOONG64LoweredPanicBoundsRC
|
||||
OpLOONG64LoweredPanicBoundsCR
|
||||
OpLOONG64LoweredPanicBoundsCC
|
||||
OpLOONG64PRELD
|
||||
OpLOONG64PRELDX
|
||||
|
||||
|
|
@ -3134,12 +3138,12 @@ const (
|
|||
OpMIPSLoweredGetCallerPC
|
||||
OpMIPSLoweredWB
|
||||
OpMIPSLoweredPubBarrier
|
||||
OpMIPSLoweredPanicBoundsA
|
||||
OpMIPSLoweredPanicBoundsB
|
||||
OpMIPSLoweredPanicBoundsC
|
||||
OpMIPSLoweredPanicExtendA
|
||||
OpMIPSLoweredPanicExtendB
|
||||
OpMIPSLoweredPanicExtendC
|
||||
OpMIPSLoweredPanicBoundsRR
|
||||
OpMIPSLoweredPanicBoundsRC
|
||||
OpMIPSLoweredPanicBoundsCR
|
||||
OpMIPSLoweredPanicBoundsCC
|
||||
OpMIPSLoweredPanicExtendRR
|
||||
OpMIPSLoweredPanicExtendRC
|
||||
|
||||
OpMIPS64ADDV
|
||||
OpMIPS64ADDVconst
|
||||
|
|
@ -3266,9 +3270,10 @@ const (
|
|||
OpMIPS64LoweredGetCallerPC
|
||||
OpMIPS64LoweredWB
|
||||
OpMIPS64LoweredPubBarrier
|
||||
OpMIPS64LoweredPanicBoundsA
|
||||
OpMIPS64LoweredPanicBoundsB
|
||||
OpMIPS64LoweredPanicBoundsC
|
||||
OpMIPS64LoweredPanicBoundsRR
|
||||
OpMIPS64LoweredPanicBoundsRC
|
||||
OpMIPS64LoweredPanicBoundsCR
|
||||
OpMIPS64LoweredPanicBoundsCC
|
||||
|
||||
OpPPC64ADD
|
||||
OpPPC64ADDCC
|
||||
|
|
@ -3637,9 +3642,10 @@ const (
|
|||
OpRISCV64LoweredGetCallerPC
|
||||
OpRISCV64LoweredWB
|
||||
OpRISCV64LoweredPubBarrier
|
||||
OpRISCV64LoweredPanicBoundsA
|
||||
OpRISCV64LoweredPanicBoundsB
|
||||
OpRISCV64LoweredPanicBoundsC
|
||||
OpRISCV64LoweredPanicBoundsRR
|
||||
OpRISCV64LoweredPanicBoundsRC
|
||||
OpRISCV64LoweredPanicBoundsCR
|
||||
OpRISCV64LoweredPanicBoundsCC
|
||||
OpRISCV64FADDS
|
||||
OpRISCV64FSUBS
|
||||
OpRISCV64FMULS
|
||||
|
|
@ -3708,6 +3714,10 @@ const (
|
|||
OpS390XLPDFR
|
||||
OpS390XLNDFR
|
||||
OpS390XCPSDR
|
||||
OpS390XWFMAXDB
|
||||
OpS390XWFMAXSB
|
||||
OpS390XWFMINDB
|
||||
OpS390XWFMINSB
|
||||
OpS390XFIDBR
|
||||
OpS390XFMOVSload
|
||||
OpS390XFMOVDload
|
||||
|
|
@ -3890,9 +3900,10 @@ const (
|
|||
OpS390XLoweredRound32F
|
||||
OpS390XLoweredRound64F
|
||||
OpS390XLoweredWB
|
||||
OpS390XLoweredPanicBoundsA
|
||||
OpS390XLoweredPanicBoundsB
|
||||
OpS390XLoweredPanicBoundsC
|
||||
OpS390XLoweredPanicBoundsRR
|
||||
OpS390XLoweredPanicBoundsRC
|
||||
OpS390XLoweredPanicBoundsCR
|
||||
OpS390XLoweredPanicBoundsCC
|
||||
OpS390XFlagEQ
|
||||
OpS390XFlagLT
|
||||
OpS390XFlagGT
|
||||
|
|
@ -9499,77 +9510,68 @@ var opcodeTable = [...]opInfo{
|
|||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsA",
|
||||
name: "LoweredPanicBoundsRR",
|
||||
auxType: auxInt64,
|
||||
argLen: 3,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 4}, // DX
|
||||
{1, 8}, // BX
|
||||
{0, 239}, // AX CX DX BX BP SI DI
|
||||
{1, 239}, // AX CX DX BX BP SI DI
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsB",
|
||||
name: "LoweredPanicBoundsRC",
|
||||
auxType: auxPanicBoundsC,
|
||||
argLen: 2,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 239}, // AX CX DX BX BP SI DI
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsCR",
|
||||
auxType: auxPanicBoundsC,
|
||||
argLen: 2,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 239}, // AX CX DX BX BP SI DI
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsCC",
|
||||
auxType: auxPanicBoundsCC,
|
||||
argLen: 1,
|
||||
call: true,
|
||||
reg: regInfo{},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicExtendRR",
|
||||
auxType: auxInt64,
|
||||
argLen: 4,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 15}, // AX CX DX BX
|
||||
{1, 15}, // AX CX DX BX
|
||||
{2, 239}, // AX CX DX BX BP SI DI
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicExtendRC",
|
||||
auxType: auxPanicBoundsC,
|
||||
argLen: 3,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 2}, // CX
|
||||
{1, 4}, // DX
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsC",
|
||||
auxType: auxInt64,
|
||||
argLen: 3,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 1}, // AX
|
||||
{1, 2}, // CX
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicExtendA",
|
||||
auxType: auxInt64,
|
||||
argLen: 4,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 64}, // SI
|
||||
{1, 4}, // DX
|
||||
{2, 8}, // BX
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicExtendB",
|
||||
auxType: auxInt64,
|
||||
argLen: 4,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 64}, // SI
|
||||
{1, 2}, // CX
|
||||
{2, 4}, // DX
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicExtendC",
|
||||
auxType: auxInt64,
|
||||
argLen: 4,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 64}, // SI
|
||||
{1, 1}, // AX
|
||||
{2, 2}, // CX
|
||||
{0, 15}, // AX CX DX BX
|
||||
{1, 15}, // AX CX DX BX
|
||||
},
|
||||
},
|
||||
},
|
||||
|
|
@ -16796,15 +16798,28 @@ var opcodeTable = [...]opInfo{
|
|||
},
|
||||
},
|
||||
{
|
||||
name: "DUFFZERO",
|
||||
auxType: auxInt64,
|
||||
argLen: 2,
|
||||
unsafePoint: true,
|
||||
name: "LoweredZero",
|
||||
auxType: auxInt64,
|
||||
argLen: 2,
|
||||
faultOnNilArg0: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 128}, // DI
|
||||
{0, 49135}, // AX CX DX BX BP SI DI R8 R9 R10 R11 R12 R13 R15
|
||||
},
|
||||
clobbers: 128, // DI
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredZeroLoop",
|
||||
auxType: auxInt64,
|
||||
argLen: 2,
|
||||
clobberFlags: true,
|
||||
needIntTemp: true,
|
||||
faultOnNilArg0: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 49135}, // AX CX DX BX BP SI DI R8 R9 R10 R11 R12 R13 R15
|
||||
},
|
||||
clobbersArg0: true,
|
||||
},
|
||||
},
|
||||
{
|
||||
|
|
@ -16977,41 +16992,46 @@ var opcodeTable = [...]opInfo{
|
|||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsA",
|
||||
name: "LoweredPanicBoundsRR",
|
||||
auxType: auxInt64,
|
||||
argLen: 3,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 4}, // DX
|
||||
{1, 8}, // BX
|
||||
{0, 49135}, // AX CX DX BX BP SI DI R8 R9 R10 R11 R12 R13 R15
|
||||
{1, 49135}, // AX CX DX BX BP SI DI R8 R9 R10 R11 R12 R13 R15
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsB",
|
||||
auxType: auxInt64,
|
||||
argLen: 3,
|
||||
name: "LoweredPanicBoundsRC",
|
||||
auxType: auxPanicBoundsC,
|
||||
argLen: 2,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 2}, // CX
|
||||
{1, 4}, // DX
|
||||
{0, 49135}, // AX CX DX BX BP SI DI R8 R9 R10 R11 R12 R13 R15
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsC",
|
||||
auxType: auxInt64,
|
||||
argLen: 3,
|
||||
name: "LoweredPanicBoundsCR",
|
||||
auxType: auxPanicBoundsC,
|
||||
argLen: 2,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 1}, // AX
|
||||
{1, 2}, // CX
|
||||
{0, 49135}, // AX CX DX BX BP SI DI R8 R9 R10 R11 R12 R13 R15
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsCC",
|
||||
auxType: auxPanicBoundsCC,
|
||||
argLen: 1,
|
||||
call: true,
|
||||
reg: regInfo{},
|
||||
},
|
||||
{
|
||||
name: "FlagEQ",
|
||||
argLen: 0,
|
||||
|
|
@ -37876,77 +37896,68 @@ var opcodeTable = [...]opInfo{
|
|||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsA",
|
||||
name: "LoweredPanicBoundsRR",
|
||||
auxType: auxInt64,
|
||||
argLen: 3,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 4}, // R2
|
||||
{1, 8}, // R3
|
||||
{0, 5119}, // R0 R1 R2 R3 R4 R5 R6 R7 R8 R9 R12
|
||||
{1, 5119}, // R0 R1 R2 R3 R4 R5 R6 R7 R8 R9 R12
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsB",
|
||||
name: "LoweredPanicBoundsRC",
|
||||
auxType: auxPanicBoundsC,
|
||||
argLen: 2,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 5119}, // R0 R1 R2 R3 R4 R5 R6 R7 R8 R9 R12
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsCR",
|
||||
auxType: auxPanicBoundsC,
|
||||
argLen: 2,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 5119}, // R0 R1 R2 R3 R4 R5 R6 R7 R8 R9 R12
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsCC",
|
||||
auxType: auxPanicBoundsCC,
|
||||
argLen: 1,
|
||||
call: true,
|
||||
reg: regInfo{},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicExtendRR",
|
||||
auxType: auxInt64,
|
||||
argLen: 4,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 15}, // R0 R1 R2 R3
|
||||
{1, 15}, // R0 R1 R2 R3
|
||||
{2, 21503}, // R0 R1 R2 R3 R4 R5 R6 R7 R8 R9 R12 R14
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicExtendRC",
|
||||
auxType: auxPanicBoundsC,
|
||||
argLen: 3,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 2}, // R1
|
||||
{1, 4}, // R2
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsC",
|
||||
auxType: auxInt64,
|
||||
argLen: 3,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 1}, // R0
|
||||
{1, 2}, // R1
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicExtendA",
|
||||
auxType: auxInt64,
|
||||
argLen: 4,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 16}, // R4
|
||||
{1, 4}, // R2
|
||||
{2, 8}, // R3
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicExtendB",
|
||||
auxType: auxInt64,
|
||||
argLen: 4,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 16}, // R4
|
||||
{1, 2}, // R1
|
||||
{2, 4}, // R2
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicExtendC",
|
||||
auxType: auxInt64,
|
||||
argLen: 4,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 16}, // R4
|
||||
{1, 1}, // R0
|
||||
{2, 2}, // R1
|
||||
{0, 15}, // R0 R1 R2 R3
|
||||
{1, 15}, // R0 R1 R2 R3
|
||||
},
|
||||
},
|
||||
},
|
||||
|
|
@ -42441,41 +42452,46 @@ var opcodeTable = [...]opInfo{
|
|||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsA",
|
||||
name: "LoweredPanicBoundsRR",
|
||||
auxType: auxInt64,
|
||||
argLen: 3,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 4}, // R2
|
||||
{1, 8}, // R3
|
||||
{0, 65535}, // R0 R1 R2 R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15
|
||||
{1, 65535}, // R0 R1 R2 R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsB",
|
||||
auxType: auxInt64,
|
||||
argLen: 3,
|
||||
name: "LoweredPanicBoundsRC",
|
||||
auxType: auxPanicBoundsC,
|
||||
argLen: 2,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 2}, // R1
|
||||
{1, 4}, // R2
|
||||
{0, 65535}, // R0 R1 R2 R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsC",
|
||||
auxType: auxInt64,
|
||||
argLen: 3,
|
||||
name: "LoweredPanicBoundsCR",
|
||||
auxType: auxPanicBoundsC,
|
||||
argLen: 2,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 1}, // R0
|
||||
{1, 2}, // R1
|
||||
{0, 65535}, // R0 R1 R2 R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsCC",
|
||||
auxType: auxPanicBoundsCC,
|
||||
argLen: 1,
|
||||
call: true,
|
||||
reg: regInfo{},
|
||||
},
|
||||
{
|
||||
name: "PRFM",
|
||||
auxType: auxInt64,
|
||||
|
|
@ -45208,41 +45224,46 @@ var opcodeTable = [...]opInfo{
|
|||
reg: regInfo{},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsA",
|
||||
name: "LoweredPanicBoundsRR",
|
||||
auxType: auxInt64,
|
||||
argLen: 3,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 4194304}, // R23
|
||||
{1, 8388608}, // R24
|
||||
{0, 524280}, // R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 R16 R17 R18 R19
|
||||
{1, 524280}, // R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 R16 R17 R18 R19
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsB",
|
||||
auxType: auxInt64,
|
||||
argLen: 3,
|
||||
name: "LoweredPanicBoundsRC",
|
||||
auxType: auxPanicBoundsC,
|
||||
argLen: 2,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 1048576}, // R21
|
||||
{1, 4194304}, // R23
|
||||
{0, 524280}, // R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 R16 R17 R18 R19
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsC",
|
||||
auxType: auxInt64,
|
||||
argLen: 3,
|
||||
name: "LoweredPanicBoundsCR",
|
||||
auxType: auxPanicBoundsC,
|
||||
argLen: 2,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 524288}, // R20
|
||||
{1, 1048576}, // R21
|
||||
{0, 524280}, // R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 R16 R17 R18 R19
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsCC",
|
||||
auxType: auxPanicBoundsCC,
|
||||
argLen: 1,
|
||||
call: true,
|
||||
reg: regInfo{},
|
||||
},
|
||||
{
|
||||
name: "PRELD",
|
||||
auxType: auxInt64,
|
||||
|
|
@ -46756,77 +46777,68 @@ var opcodeTable = [...]opInfo{
|
|||
reg: regInfo{},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsA",
|
||||
name: "LoweredPanicBoundsRR",
|
||||
auxType: auxInt64,
|
||||
argLen: 3,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 8}, // R3
|
||||
{1, 16}, // R4
|
||||
{0, 131070}, // R1 R2 R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 R16
|
||||
{1, 131070}, // R1 R2 R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 R16
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsB",
|
||||
name: "LoweredPanicBoundsRC",
|
||||
auxType: auxPanicBoundsC,
|
||||
argLen: 2,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 131070}, // R1 R2 R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 R16
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsCR",
|
||||
auxType: auxPanicBoundsC,
|
||||
argLen: 2,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 131070}, // R1 R2 R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 R16
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsCC",
|
||||
auxType: auxPanicBoundsCC,
|
||||
argLen: 1,
|
||||
call: true,
|
||||
reg: regInfo{},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicExtendRR",
|
||||
auxType: auxInt64,
|
||||
argLen: 4,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 30}, // R1 R2 R3 R4
|
||||
{1, 30}, // R1 R2 R3 R4
|
||||
{2, 131070}, // R1 R2 R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 R16
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicExtendRC",
|
||||
auxType: auxPanicBoundsC,
|
||||
argLen: 3,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 4}, // R2
|
||||
{1, 8}, // R3
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsC",
|
||||
auxType: auxInt64,
|
||||
argLen: 3,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 2}, // R1
|
||||
{1, 4}, // R2
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicExtendA",
|
||||
auxType: auxInt64,
|
||||
argLen: 4,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 32}, // R5
|
||||
{1, 8}, // R3
|
||||
{2, 16}, // R4
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicExtendB",
|
||||
auxType: auxInt64,
|
||||
argLen: 4,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 32}, // R5
|
||||
{1, 4}, // R2
|
||||
{2, 8}, // R3
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicExtendC",
|
||||
auxType: auxInt64,
|
||||
argLen: 4,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 32}, // R5
|
||||
{1, 2}, // R1
|
||||
{2, 4}, // R2
|
||||
{0, 30}, // R1 R2 R3 R4
|
||||
{1, 30}, // R1 R2 R3 R4
|
||||
},
|
||||
},
|
||||
},
|
||||
|
|
@ -48529,41 +48541,46 @@ var opcodeTable = [...]opInfo{
|
|||
reg: regInfo{},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsA",
|
||||
name: "LoweredPanicBoundsRR",
|
||||
auxType: auxInt64,
|
||||
argLen: 3,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 8}, // R3
|
||||
{1, 16}, // R4
|
||||
{0, 131070}, // R1 R2 R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 R16
|
||||
{1, 131070}, // R1 R2 R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 R16
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsB",
|
||||
auxType: auxInt64,
|
||||
argLen: 3,
|
||||
name: "LoweredPanicBoundsRC",
|
||||
auxType: auxPanicBoundsC,
|
||||
argLen: 2,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 4}, // R2
|
||||
{1, 8}, // R3
|
||||
{0, 131070}, // R1 R2 R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 R16
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsC",
|
||||
auxType: auxInt64,
|
||||
argLen: 3,
|
||||
name: "LoweredPanicBoundsCR",
|
||||
auxType: auxPanicBoundsC,
|
||||
argLen: 2,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 2}, // R1
|
||||
{1, 4}, // R2
|
||||
{0, 131070}, // R1 R2 R3 R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 R16
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsCC",
|
||||
auxType: auxPanicBoundsCC,
|
||||
argLen: 1,
|
||||
call: true,
|
||||
reg: regInfo{},
|
||||
},
|
||||
|
||||
{
|
||||
name: "ADD",
|
||||
|
|
@ -53530,41 +53547,46 @@ var opcodeTable = [...]opInfo{
|
|||
reg: regInfo{},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsA",
|
||||
name: "LoweredPanicBoundsRR",
|
||||
auxType: auxInt64,
|
||||
argLen: 3,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 64}, // X7
|
||||
{1, 134217728}, // X28
|
||||
{0, 1048560}, // X5 X6 X7 X8 X9 X10 X11 X12 X13 X14 X15 X16 X17 X18 X19 X20
|
||||
{1, 1048560}, // X5 X6 X7 X8 X9 X10 X11 X12 X13 X14 X15 X16 X17 X18 X19 X20
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsB",
|
||||
auxType: auxInt64,
|
||||
argLen: 3,
|
||||
name: "LoweredPanicBoundsRC",
|
||||
auxType: auxPanicBoundsC,
|
||||
argLen: 2,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 32}, // X6
|
||||
{1, 64}, // X7
|
||||
{0, 1048560}, // X5 X6 X7 X8 X9 X10 X11 X12 X13 X14 X15 X16 X17 X18 X19 X20
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsC",
|
||||
auxType: auxInt64,
|
||||
argLen: 3,
|
||||
name: "LoweredPanicBoundsCR",
|
||||
auxType: auxPanicBoundsC,
|
||||
argLen: 2,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 16}, // X5
|
||||
{1, 32}, // X6
|
||||
{0, 1048560}, // X5 X6 X7 X8 X9 X10 X11 X12 X13 X14 X15 X16 X17 X18 X19 X20
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsCC",
|
||||
auxType: auxPanicBoundsCC,
|
||||
argLen: 1,
|
||||
call: true,
|
||||
reg: regInfo{},
|
||||
},
|
||||
{
|
||||
name: "FADDS",
|
||||
argLen: 2,
|
||||
|
|
@ -54541,6 +54563,62 @@ var opcodeTable = [...]opInfo{
|
|||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "WFMAXDB",
|
||||
argLen: 2,
|
||||
asm: s390x.AWFMAXDB,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 4294901760}, // F0 F1 F2 F3 F4 F5 F6 F7 F8 F9 F10 F11 F12 F13 F14 F15
|
||||
{1, 4294901760}, // F0 F1 F2 F3 F4 F5 F6 F7 F8 F9 F10 F11 F12 F13 F14 F15
|
||||
},
|
||||
outputs: []outputInfo{
|
||||
{0, 4294901760}, // F0 F1 F2 F3 F4 F5 F6 F7 F8 F9 F10 F11 F12 F13 F14 F15
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "WFMAXSB",
|
||||
argLen: 2,
|
||||
asm: s390x.AWFMAXSB,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 4294901760}, // F0 F1 F2 F3 F4 F5 F6 F7 F8 F9 F10 F11 F12 F13 F14 F15
|
||||
{1, 4294901760}, // F0 F1 F2 F3 F4 F5 F6 F7 F8 F9 F10 F11 F12 F13 F14 F15
|
||||
},
|
||||
outputs: []outputInfo{
|
||||
{0, 4294901760}, // F0 F1 F2 F3 F4 F5 F6 F7 F8 F9 F10 F11 F12 F13 F14 F15
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "WFMINDB",
|
||||
argLen: 2,
|
||||
asm: s390x.AWFMINDB,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 4294901760}, // F0 F1 F2 F3 F4 F5 F6 F7 F8 F9 F10 F11 F12 F13 F14 F15
|
||||
{1, 4294901760}, // F0 F1 F2 F3 F4 F5 F6 F7 F8 F9 F10 F11 F12 F13 F14 F15
|
||||
},
|
||||
outputs: []outputInfo{
|
||||
{0, 4294901760}, // F0 F1 F2 F3 F4 F5 F6 F7 F8 F9 F10 F11 F12 F13 F14 F15
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "WFMINSB",
|
||||
argLen: 2,
|
||||
asm: s390x.AWFMINSB,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 4294901760}, // F0 F1 F2 F3 F4 F5 F6 F7 F8 F9 F10 F11 F12 F13 F14 F15
|
||||
{1, 4294901760}, // F0 F1 F2 F3 F4 F5 F6 F7 F8 F9 F10 F11 F12 F13 F14 F15
|
||||
},
|
||||
outputs: []outputInfo{
|
||||
{0, 4294901760}, // F0 F1 F2 F3 F4 F5 F6 F7 F8 F9 F10 F11 F12 F13 F14 F15
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "FIDBR",
|
||||
auxType: auxInt8,
|
||||
|
|
@ -57211,41 +57289,46 @@ var opcodeTable = [...]opInfo{
|
|||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsA",
|
||||
name: "LoweredPanicBoundsRR",
|
||||
auxType: auxInt64,
|
||||
argLen: 3,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 4}, // R2
|
||||
{1, 8}, // R3
|
||||
{0, 7167}, // R0 R1 R2 R3 R4 R5 R6 R7 R8 R9 R11 R12
|
||||
{1, 7167}, // R0 R1 R2 R3 R4 R5 R6 R7 R8 R9 R11 R12
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsB",
|
||||
auxType: auxInt64,
|
||||
argLen: 3,
|
||||
name: "LoweredPanicBoundsRC",
|
||||
auxType: auxPanicBoundsC,
|
||||
argLen: 2,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 2}, // R1
|
||||
{1, 4}, // R2
|
||||
{0, 7167}, // R0 R1 R2 R3 R4 R5 R6 R7 R8 R9 R11 R12
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsC",
|
||||
auxType: auxInt64,
|
||||
argLen: 3,
|
||||
name: "LoweredPanicBoundsCR",
|
||||
auxType: auxPanicBoundsC,
|
||||
argLen: 2,
|
||||
call: true,
|
||||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 1}, // R0
|
||||
{1, 2}, // R1
|
||||
{0, 7167}, // R0 R1 R2 R3 R4 R5 R6 R7 R8 R9 R11 R12
|
||||
},
|
||||
},
|
||||
},
|
||||
{
|
||||
name: "LoweredPanicBoundsCC",
|
||||
auxType: auxPanicBoundsCC,
|
||||
argLen: 1,
|
||||
call: true,
|
||||
reg: regInfo{},
|
||||
},
|
||||
{
|
||||
name: "FlagEQ",
|
||||
argLen: 0,
|
||||
|
|
|
|||
|
|
@ -5,6 +5,7 @@
|
|||
package ssa
|
||||
|
||||
import (
|
||||
"cmd/compile/internal/types"
|
||||
"cmd/internal/src"
|
||||
"fmt"
|
||||
"math"
|
||||
|
|
@ -2132,6 +2133,41 @@ func addRestrictions(parent *Block, ft *factsTable, t domain, v, w *Value, r rel
|
|||
}
|
||||
}
|
||||
|
||||
func unsignedAddOverflows(a, b uint64, t *types.Type) bool {
|
||||
switch t.Size() {
|
||||
case 8:
|
||||
return a+b < a
|
||||
case 4:
|
||||
return a+b > math.MaxUint32
|
||||
case 2:
|
||||
return a+b > math.MaxUint16
|
||||
case 1:
|
||||
return a+b > math.MaxUint8
|
||||
default:
|
||||
panic("unreachable")
|
||||
}
|
||||
}
|
||||
|
||||
func signedAddOverflowsOrUnderflows(a, b int64, t *types.Type) bool {
|
||||
r := a + b
|
||||
switch t.Size() {
|
||||
case 8:
|
||||
return (a >= 0 && b >= 0 && r < 0) || (a < 0 && b < 0 && r >= 0)
|
||||
case 4:
|
||||
return r < math.MinInt32 || math.MaxInt32 < r
|
||||
case 2:
|
||||
return r < math.MinInt16 || math.MaxInt16 < r
|
||||
case 1:
|
||||
return r < math.MinInt8 || math.MaxInt8 < r
|
||||
default:
|
||||
panic("unreachable")
|
||||
}
|
||||
}
|
||||
|
||||
func unsignedSubUnderflows(a, b uint64) bool {
|
||||
return a < b
|
||||
}
|
||||
|
||||
func addLocalFacts(ft *factsTable, b *Block) {
|
||||
// Propagate constant ranges among values in this block.
|
||||
// We do this before the second loop so that we have the
|
||||
|
|
@ -2151,6 +2187,60 @@ func addLocalFacts(ft *factsTable, b *Block) {
|
|||
// FIXME(go.dev/issue/68857): this loop only set up limits properly when b.Values is in topological order.
|
||||
// flowLimit can also depend on limits given by this loop which right now is not handled.
|
||||
switch v.Op {
|
||||
case OpAdd64, OpAdd32, OpAdd16, OpAdd8:
|
||||
x := ft.limits[v.Args[0].ID]
|
||||
y := ft.limits[v.Args[1].ID]
|
||||
if !unsignedAddOverflows(x.umax, y.umax, v.Type) {
|
||||
r := gt
|
||||
if !x.nonzero() {
|
||||
r |= eq
|
||||
}
|
||||
ft.update(b, v, v.Args[1], unsigned, r)
|
||||
r = gt
|
||||
if !y.nonzero() {
|
||||
r |= eq
|
||||
}
|
||||
ft.update(b, v, v.Args[0], unsigned, r)
|
||||
}
|
||||
if x.min >= 0 && !signedAddOverflowsOrUnderflows(x.max, y.max, v.Type) {
|
||||
r := gt
|
||||
if !x.nonzero() {
|
||||
r |= eq
|
||||
}
|
||||
ft.update(b, v, v.Args[1], signed, r)
|
||||
}
|
||||
if y.min >= 0 && !signedAddOverflowsOrUnderflows(x.max, y.max, v.Type) {
|
||||
r := gt
|
||||
if !y.nonzero() {
|
||||
r |= eq
|
||||
}
|
||||
ft.update(b, v, v.Args[0], signed, r)
|
||||
}
|
||||
if x.max <= 0 && !signedAddOverflowsOrUnderflows(x.min, y.min, v.Type) {
|
||||
r := lt
|
||||
if !x.nonzero() {
|
||||
r |= eq
|
||||
}
|
||||
ft.update(b, v, v.Args[1], signed, r)
|
||||
}
|
||||
if y.max <= 0 && !signedAddOverflowsOrUnderflows(x.min, y.min, v.Type) {
|
||||
r := lt
|
||||
if !y.nonzero() {
|
||||
r |= eq
|
||||
}
|
||||
ft.update(b, v, v.Args[0], signed, r)
|
||||
}
|
||||
case OpSub64, OpSub32, OpSub16, OpSub8:
|
||||
x := ft.limits[v.Args[0].ID]
|
||||
y := ft.limits[v.Args[1].ID]
|
||||
if !unsignedSubUnderflows(x.umin, y.umax) {
|
||||
r := lt
|
||||
if !y.nonzero() {
|
||||
r |= eq
|
||||
}
|
||||
ft.update(b, v, v.Args[0], unsigned, r)
|
||||
}
|
||||
// FIXME: we could also do signed facts but the overflow checks are much trickier and I don't need it yet.
|
||||
case OpAnd64, OpAnd32, OpAnd16, OpAnd8:
|
||||
ft.update(b, v, v.Args[0], unsigned, lt|eq)
|
||||
ft.update(b, v, v.Args[1], unsigned, lt|eq)
|
||||
|
|
@ -2177,6 +2267,10 @@ func addLocalFacts(ft *factsTable, b *Block) {
|
|||
// the mod instruction executes (and thus panics if the
|
||||
// modulus is 0). See issue 67625.
|
||||
ft.update(b, v, v.Args[1], unsigned, lt)
|
||||
case OpStringLen:
|
||||
if v.Args[0].Op == OpStringMake {
|
||||
ft.update(b, v, v.Args[0].Args[1], signed, eq)
|
||||
}
|
||||
case OpSliceLen:
|
||||
if v.Args[0].Op == OpSliceMake {
|
||||
ft.update(b, v, v.Args[0].Args[1], signed, eq)
|
||||
|
|
|
|||
|
|
@ -1591,6 +1591,12 @@ func (s *regAllocState) regalloc(f *Func) {
|
|||
mask &^= desired.avoid
|
||||
}
|
||||
}
|
||||
if mask&s.values[v.Args[i.idx].ID].regs&(1<<s.SPReg) != 0 {
|
||||
// Prefer SP register. This ensures that local variables
|
||||
// use SP as their base register (instead of a copy of the
|
||||
// stack pointer living in another register). See issue 74836.
|
||||
mask = 1 << s.SPReg
|
||||
}
|
||||
args[i.idx] = s.allocValToReg(v.Args[i.idx], mask, true, v.Pos)
|
||||
}
|
||||
|
||||
|
|
@ -1694,8 +1700,38 @@ func (s *regAllocState) regalloc(f *Func) {
|
|||
}
|
||||
}
|
||||
}
|
||||
|
||||
ok:
|
||||
for i := 0; i < 2; i++ {
|
||||
if !(i == 0 && regspec.clobbersArg0 || i == 1 && regspec.clobbersArg1) {
|
||||
continue
|
||||
}
|
||||
if !s.liveAfterCurrentInstruction(v.Args[i]) {
|
||||
// arg is dead. We can clobber its register.
|
||||
continue
|
||||
}
|
||||
if s.values[v.Args[i].ID].rematerializeable {
|
||||
// We can rematerialize the input, don't worry about clobbering it.
|
||||
continue
|
||||
}
|
||||
if countRegs(s.values[v.Args[i].ID].regs) >= 2 {
|
||||
// We have at least 2 copies of arg. We can afford to clobber one.
|
||||
continue
|
||||
}
|
||||
// Possible new registers to copy into.
|
||||
m := s.compatRegs(v.Args[i].Type) &^ s.used
|
||||
if m == 0 {
|
||||
// No free registers. In this case we'll just clobber the
|
||||
// input and future uses of that input must use a restore.
|
||||
// TODO(khr): We should really do this like allocReg does it,
|
||||
// spilling the value with the most distant next use.
|
||||
continue
|
||||
}
|
||||
// Copy input to a new clobberable register.
|
||||
c := s.allocValToReg(v.Args[i], m, true, v.Pos)
|
||||
s.copies[c] = false
|
||||
args[i] = c
|
||||
}
|
||||
|
||||
// Pick a temporary register if needed.
|
||||
// It should be distinct from all the input registers, so we
|
||||
// allocate it after all the input registers, but before
|
||||
|
|
@ -1717,6 +1753,13 @@ func (s *regAllocState) regalloc(f *Func) {
|
|||
s.tmpused |= regMask(1) << tmpReg
|
||||
}
|
||||
|
||||
if regspec.clobbersArg0 {
|
||||
s.freeReg(register(s.f.getHome(args[0].ID).(*Register).num))
|
||||
}
|
||||
if regspec.clobbersArg1 {
|
||||
s.freeReg(register(s.f.getHome(args[1].ID).(*Register).num))
|
||||
}
|
||||
|
||||
// Now that all args are in regs, we're ready to issue the value itself.
|
||||
// Before we pick a register for the output value, allow input registers
|
||||
// to be deallocated. We do this here so that the output can use the
|
||||
|
|
@ -2743,7 +2786,7 @@ func (s *regAllocState) computeLive() {
|
|||
// out to all of them.
|
||||
po := f.postorder()
|
||||
s.loopnest = f.loopnest()
|
||||
s.loopnest.calculateDepths()
|
||||
s.loopnest.computeUnavoidableCalls()
|
||||
for {
|
||||
changed := false
|
||||
|
||||
|
|
@ -3050,3 +3093,72 @@ func (d *desiredState) merge(x *desiredState) {
|
|||
d.addList(e.ID, e.regs)
|
||||
}
|
||||
}
|
||||
|
||||
// computeUnavoidableCalls computes the containsUnavoidableCall fields in the loop nest.
|
||||
func (loopnest *loopnest) computeUnavoidableCalls() {
|
||||
f := loopnest.f
|
||||
|
||||
hasCall := f.Cache.allocBoolSlice(f.NumBlocks())
|
||||
defer f.Cache.freeBoolSlice(hasCall)
|
||||
for _, b := range f.Blocks {
|
||||
if b.containsCall() {
|
||||
hasCall[b.ID] = true
|
||||
}
|
||||
}
|
||||
found := f.Cache.allocSparseSet(f.NumBlocks())
|
||||
defer f.Cache.freeSparseSet(found)
|
||||
// Run dfs to find path through the loop that avoids all calls.
|
||||
// Such path either escapes the loop or returns back to the header.
|
||||
// It isn't enough to have exit not dominated by any call, for example:
|
||||
// ... some loop
|
||||
// call1 call2
|
||||
// \ /
|
||||
// block
|
||||
// ...
|
||||
// block is not dominated by any single call, but we don't have call-free path to it.
|
||||
loopLoop:
|
||||
for _, l := range loopnest.loops {
|
||||
found.clear()
|
||||
tovisit := make([]*Block, 0, 8)
|
||||
tovisit = append(tovisit, l.header)
|
||||
for len(tovisit) > 0 {
|
||||
cur := tovisit[len(tovisit)-1]
|
||||
tovisit = tovisit[:len(tovisit)-1]
|
||||
if hasCall[cur.ID] {
|
||||
continue
|
||||
}
|
||||
for _, s := range cur.Succs {
|
||||
nb := s.Block()
|
||||
if nb == l.header {
|
||||
// Found a call-free path around the loop.
|
||||
continue loopLoop
|
||||
}
|
||||
if found.contains(nb.ID) {
|
||||
// Already found via another path.
|
||||
continue
|
||||
}
|
||||
nl := loopnest.b2l[nb.ID]
|
||||
if nl == nil || (nl.depth <= l.depth && nl != l) {
|
||||
// Left the loop.
|
||||
continue
|
||||
}
|
||||
tovisit = append(tovisit, nb)
|
||||
found.add(nb.ID)
|
||||
}
|
||||
}
|
||||
// No call-free path was found.
|
||||
l.containsUnavoidableCall = true
|
||||
}
|
||||
}
|
||||
|
||||
func (b *Block) containsCall() bool {
|
||||
if b.Kind == BlockDefer {
|
||||
return true
|
||||
}
|
||||
for _, v := range b.Values {
|
||||
if opcodeTable[v.Op].call {
|
||||
return true
|
||||
}
|
||||
}
|
||||
return false
|
||||
}
|
||||
|
|
|
|||
|
|
@ -6,6 +6,7 @@ package ssa
|
|||
|
||||
import (
|
||||
"cmd/compile/internal/types"
|
||||
"fmt"
|
||||
"testing"
|
||||
)
|
||||
|
||||
|
|
@ -218,10 +219,37 @@ func TestSpillMove2(t *testing.T) {
|
|||
|
||||
}
|
||||
|
||||
func TestClobbersArg0(t *testing.T) {
|
||||
c := testConfig(t)
|
||||
f := c.Fun("entry",
|
||||
Bloc("entry",
|
||||
Valu("mem", OpInitMem, types.TypeMem, 0, nil),
|
||||
Valu("ptr", OpArg, c.config.Types.Int64.PtrTo(), 0, c.Temp(c.config.Types.Int64.PtrTo())),
|
||||
Valu("dst", OpArg, c.config.Types.Int64.PtrTo().PtrTo(), 0, c.Temp(c.config.Types.Int64.PtrTo().PtrTo())),
|
||||
Valu("zero", OpAMD64LoweredZeroLoop, types.TypeMem, 256, nil, "ptr", "mem"),
|
||||
Valu("store", OpAMD64MOVQstore, types.TypeMem, 0, nil, "dst", "ptr", "zero"),
|
||||
Exit("store")))
|
||||
flagalloc(f.f)
|
||||
regalloc(f.f)
|
||||
checkFunc(f.f)
|
||||
// LoweredZeroLoop clobbers its argument, so there must be a copy of "ptr" somewhere
|
||||
// so we still have that value available at "store".
|
||||
if n := numCopies(f.blocks["entry"]); n != 1 {
|
||||
fmt.Printf("%s\n", f.f.String())
|
||||
t.Errorf("got %d copies, want 1", n)
|
||||
}
|
||||
}
|
||||
|
||||
func numSpills(b *Block) int {
|
||||
return numOps(b, OpStoreReg)
|
||||
}
|
||||
func numCopies(b *Block) int {
|
||||
return numOps(b, OpCopy)
|
||||
}
|
||||
func numOps(b *Block, op Op) int {
|
||||
n := 0
|
||||
for _, v := range b.Values {
|
||||
if v.Op == OpStoreReg {
|
||||
if v.Op == op {
|
||||
n++
|
||||
}
|
||||
}
|
||||
|
|
|
|||
|
|
@ -29,6 +29,8 @@ type deadValueChoice bool
|
|||
const (
|
||||
leaveDeadValues deadValueChoice = false
|
||||
removeDeadValues = true
|
||||
|
||||
repZeroThreshold = 1408 // size beyond which we use REP STOS for zeroing
|
||||
)
|
||||
|
||||
// deadcode indicates whether rewrite should try to remove any values that become dead.
|
||||
|
|
@ -199,16 +201,18 @@ func applyRewrite(f *Func, rb blockRewriter, rv valueRewriter, deadcode deadValu
|
|||
f.freeValue(v)
|
||||
continue
|
||||
}
|
||||
if v.Pos.IsStmt() != src.PosNotStmt && !notStmtBoundary(v.Op) && pendingLines.get(vl) == int32(b.ID) {
|
||||
pendingLines.remove(vl)
|
||||
v.Pos = v.Pos.WithIsStmt()
|
||||
if v.Pos.IsStmt() != src.PosNotStmt && !notStmtBoundary(v.Op) {
|
||||
if pl, ok := pendingLines.get(vl); ok && pl == int32(b.ID) {
|
||||
pendingLines.remove(vl)
|
||||
v.Pos = v.Pos.WithIsStmt()
|
||||
}
|
||||
}
|
||||
if i != j {
|
||||
b.Values[j] = v
|
||||
}
|
||||
j++
|
||||
}
|
||||
if pendingLines.get(b.Pos) == int32(b.ID) {
|
||||
if pl, ok := pendingLines.get(b.Pos); ok && pl == int32(b.ID) {
|
||||
b.Pos = b.Pos.WithIsStmt()
|
||||
pendingLines.remove(b.Pos)
|
||||
}
|
||||
|
|
@ -301,7 +305,6 @@ func canMergeLoadClobber(target, load, x *Value) bool {
|
|||
return false
|
||||
}
|
||||
loopnest := x.Block.Func.loopnest()
|
||||
loopnest.calculateDepths()
|
||||
if loopnest.depth(target.Block.ID) > loopnest.depth(x.Block.ID) {
|
||||
return false
|
||||
}
|
||||
|
|
@ -479,30 +482,28 @@ func nto(x int64) int64 {
|
|||
|
||||
// logX returns logarithm of n base 2.
|
||||
// n must be a positive power of 2 (isPowerOfTwoX returns true).
|
||||
func log8(n int8) int64 {
|
||||
return int64(bits.Len8(uint8(n))) - 1
|
||||
}
|
||||
func log16(n int16) int64 {
|
||||
return int64(bits.Len16(uint16(n))) - 1
|
||||
}
|
||||
func log32(n int32) int64 {
|
||||
return int64(bits.Len32(uint32(n))) - 1
|
||||
}
|
||||
func log64(n int64) int64 {
|
||||
return int64(bits.Len64(uint64(n))) - 1
|
||||
}
|
||||
func log8(n int8) int64 { return log8u(uint8(n)) }
|
||||
func log16(n int16) int64 { return log16u(uint16(n)) }
|
||||
func log32(n int32) int64 { return log32u(uint32(n)) }
|
||||
func log64(n int64) int64 { return log64u(uint64(n)) }
|
||||
|
||||
// log2uint32 returns logarithm in base 2 of uint32(n), with log2(0) = -1.
|
||||
// Rounds down.
|
||||
func log2uint32(n int64) int64 {
|
||||
return int64(bits.Len32(uint32(n))) - 1
|
||||
}
|
||||
// logXu returns the logarithm of n base 2.
|
||||
// n must be a power of 2 (isUnsignedPowerOfTwo returns true)
|
||||
func log8u(n uint8) int64 { return int64(bits.Len8(n)) - 1 }
|
||||
func log16u(n uint16) int64 { return int64(bits.Len16(n)) - 1 }
|
||||
func log32u(n uint32) int64 { return int64(bits.Len32(n)) - 1 }
|
||||
func log64u(n uint64) int64 { return int64(bits.Len64(n)) - 1 }
|
||||
|
||||
// isPowerOfTwoX functions report whether n is a power of 2.
|
||||
func isPowerOfTwo[T int8 | int16 | int32 | int64](n T) bool {
|
||||
return n > 0 && n&(n-1) == 0
|
||||
}
|
||||
|
||||
// isUnsignedPowerOfTwo reports whether n is an unsigned power of 2.
|
||||
func isUnsignedPowerOfTwo[T uint8 | uint16 | uint32 | uint64](n T) bool {
|
||||
return n != 0 && n&(n-1) == 0
|
||||
}
|
||||
|
||||
// isUint64PowerOfTwo reports whether uint64(n) is a power of 2.
|
||||
func isUint64PowerOfTwo(in int64) bool {
|
||||
n := uint64(in)
|
||||
|
|
@ -2671,3 +2672,32 @@ func flagify(v *Value) bool {
|
|||
v.AddArg(inner)
|
||||
return true
|
||||
}
|
||||
|
||||
// PanicBoundsC contains a constant for a bounds failure.
|
||||
type PanicBoundsC struct {
|
||||
C int64
|
||||
}
|
||||
|
||||
// PanicBoundsCC contains 2 constants for a bounds failure.
|
||||
type PanicBoundsCC struct {
|
||||
Cx int64
|
||||
Cy int64
|
||||
}
|
||||
|
||||
func (p PanicBoundsC) CanBeAnSSAAux() {
|
||||
}
|
||||
func (p PanicBoundsCC) CanBeAnSSAAux() {
|
||||
}
|
||||
|
||||
func auxToPanicBoundsC(i Aux) PanicBoundsC {
|
||||
return i.(PanicBoundsC)
|
||||
}
|
||||
func auxToPanicBoundsCC(i Aux) PanicBoundsCC {
|
||||
return i.(PanicBoundsCC)
|
||||
}
|
||||
func panicBoundsCToAux(p PanicBoundsC) Aux {
|
||||
return p
|
||||
}
|
||||
func panicBoundsCCToAux(p PanicBoundsCC) Aux {
|
||||
return p
|
||||
}
|
||||
|
|
|
|||
|
|
@ -75,6 +75,14 @@ func rewriteValue386(v *Value) bool {
|
|||
return rewriteValue386_Op386LEAL4(v)
|
||||
case Op386LEAL8:
|
||||
return rewriteValue386_Op386LEAL8(v)
|
||||
case Op386LoweredPanicBoundsRC:
|
||||
return rewriteValue386_Op386LoweredPanicBoundsRC(v)
|
||||
case Op386LoweredPanicBoundsRR:
|
||||
return rewriteValue386_Op386LoweredPanicBoundsRR(v)
|
||||
case Op386LoweredPanicExtendRC:
|
||||
return rewriteValue386_Op386LoweredPanicExtendRC(v)
|
||||
case Op386LoweredPanicExtendRR:
|
||||
return rewriteValue386_Op386LoweredPanicExtendRR(v)
|
||||
case Op386MOVBLSX:
|
||||
return rewriteValue386_Op386MOVBLSX(v)
|
||||
case Op386MOVBLSXload:
|
||||
|
|
@ -558,9 +566,11 @@ func rewriteValue386(v *Value) bool {
|
|||
v.Op = Op386ORL
|
||||
return true
|
||||
case OpPanicBounds:
|
||||
return rewriteValue386_OpPanicBounds(v)
|
||||
v.Op = Op386LoweredPanicBoundsRR
|
||||
return true
|
||||
case OpPanicExtend:
|
||||
return rewriteValue386_OpPanicExtend(v)
|
||||
v.Op = Op386LoweredPanicExtendRR
|
||||
return true
|
||||
case OpRotateLeft16:
|
||||
v.Op = Op386ROLW
|
||||
return true
|
||||
|
|
@ -3398,6 +3408,135 @@ func rewriteValue386_Op386LEAL8(v *Value) bool {
|
|||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValue386_Op386LoweredPanicBoundsRC(v *Value) bool {
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (LoweredPanicBoundsRC [kind] {p} (MOVLconst [c]) mem)
|
||||
// result: (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:int64(c), Cy:p.C}} mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
p := auxToPanicBoundsC(v.Aux)
|
||||
if v_0.Op != Op386MOVLconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt32(v_0.AuxInt)
|
||||
mem := v_1
|
||||
v.reset(Op386LoweredPanicBoundsCC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCCToAux(PanicBoundsCC{Cx: int64(c), Cy: p.C})
|
||||
v.AddArg(mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValue386_Op386LoweredPanicBoundsRR(v *Value) bool {
|
||||
v_2 := v.Args[2]
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (LoweredPanicBoundsRR [kind] x (MOVLconst [c]) mem)
|
||||
// result: (LoweredPanicBoundsRC [kind] x {PanicBoundsC{C:int64(c)}} mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
x := v_0
|
||||
if v_1.Op != Op386MOVLconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt32(v_1.AuxInt)
|
||||
mem := v_2
|
||||
v.reset(Op386LoweredPanicBoundsRC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCToAux(PanicBoundsC{C: int64(c)})
|
||||
v.AddArg2(x, mem)
|
||||
return true
|
||||
}
|
||||
// match: (LoweredPanicBoundsRR [kind] (MOVLconst [c]) y mem)
|
||||
// result: (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:int64(c)}} y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
if v_0.Op != Op386MOVLconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt32(v_0.AuxInt)
|
||||
y := v_1
|
||||
mem := v_2
|
||||
v.reset(Op386LoweredPanicBoundsCR)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCToAux(PanicBoundsC{C: int64(c)})
|
||||
v.AddArg2(y, mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValue386_Op386LoweredPanicExtendRC(v *Value) bool {
|
||||
v_2 := v.Args[2]
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (LoweredPanicExtendRC [kind] {p} (MOVLconst [hi]) (MOVLconst [lo]) mem)
|
||||
// result: (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:int64(hi)<<32+int64(uint32(lo)), Cy:p.C}} mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
p := auxToPanicBoundsC(v.Aux)
|
||||
if v_0.Op != Op386MOVLconst {
|
||||
break
|
||||
}
|
||||
hi := auxIntToInt32(v_0.AuxInt)
|
||||
if v_1.Op != Op386MOVLconst {
|
||||
break
|
||||
}
|
||||
lo := auxIntToInt32(v_1.AuxInt)
|
||||
mem := v_2
|
||||
v.reset(Op386LoweredPanicBoundsCC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCCToAux(PanicBoundsCC{Cx: int64(hi)<<32 + int64(uint32(lo)), Cy: p.C})
|
||||
v.AddArg(mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValue386_Op386LoweredPanicExtendRR(v *Value) bool {
|
||||
v_3 := v.Args[3]
|
||||
v_2 := v.Args[2]
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (LoweredPanicExtendRR [kind] hi lo (MOVLconst [c]) mem)
|
||||
// result: (LoweredPanicExtendRC [kind] hi lo {PanicBoundsC{C:int64(c)}} mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
hi := v_0
|
||||
lo := v_1
|
||||
if v_2.Op != Op386MOVLconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt32(v_2.AuxInt)
|
||||
mem := v_3
|
||||
v.reset(Op386LoweredPanicExtendRC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCToAux(PanicBoundsC{C: int64(c)})
|
||||
v.AddArg3(hi, lo, mem)
|
||||
return true
|
||||
}
|
||||
// match: (LoweredPanicExtendRR [kind] (MOVLconst [hi]) (MOVLconst [lo]) y mem)
|
||||
// result: (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:int64(hi)<<32 + int64(uint32(lo))}} y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
if v_0.Op != Op386MOVLconst {
|
||||
break
|
||||
}
|
||||
hi := auxIntToInt32(v_0.AuxInt)
|
||||
if v_1.Op != Op386MOVLconst {
|
||||
break
|
||||
}
|
||||
lo := auxIntToInt32(v_1.AuxInt)
|
||||
y := v_2
|
||||
mem := v_3
|
||||
v.reset(Op386LoweredPanicBoundsCR)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCToAux(PanicBoundsC{C: int64(hi)<<32 + int64(uint32(lo))})
|
||||
v.AddArg2(y, mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValue386_Op386MOVBLSX(v *Value) bool {
|
||||
v_0 := v.Args[0]
|
||||
b := v.Block
|
||||
|
|
@ -9313,118 +9452,6 @@ func rewriteValue386_OpOffPtr(v *Value) bool {
|
|||
return true
|
||||
}
|
||||
}
|
||||
func rewriteValue386_OpPanicBounds(v *Value) bool {
|
||||
v_2 := v.Args[2]
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (PanicBounds [kind] x y mem)
|
||||
// cond: boundsABI(kind) == 0
|
||||
// result: (LoweredPanicBoundsA [kind] x y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
x := v_0
|
||||
y := v_1
|
||||
mem := v_2
|
||||
if !(boundsABI(kind) == 0) {
|
||||
break
|
||||
}
|
||||
v.reset(Op386LoweredPanicBoundsA)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.AddArg3(x, y, mem)
|
||||
return true
|
||||
}
|
||||
// match: (PanicBounds [kind] x y mem)
|
||||
// cond: boundsABI(kind) == 1
|
||||
// result: (LoweredPanicBoundsB [kind] x y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
x := v_0
|
||||
y := v_1
|
||||
mem := v_2
|
||||
if !(boundsABI(kind) == 1) {
|
||||
break
|
||||
}
|
||||
v.reset(Op386LoweredPanicBoundsB)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.AddArg3(x, y, mem)
|
||||
return true
|
||||
}
|
||||
// match: (PanicBounds [kind] x y mem)
|
||||
// cond: boundsABI(kind) == 2
|
||||
// result: (LoweredPanicBoundsC [kind] x y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
x := v_0
|
||||
y := v_1
|
||||
mem := v_2
|
||||
if !(boundsABI(kind) == 2) {
|
||||
break
|
||||
}
|
||||
v.reset(Op386LoweredPanicBoundsC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.AddArg3(x, y, mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValue386_OpPanicExtend(v *Value) bool {
|
||||
v_3 := v.Args[3]
|
||||
v_2 := v.Args[2]
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (PanicExtend [kind] hi lo y mem)
|
||||
// cond: boundsABI(kind) == 0
|
||||
// result: (LoweredPanicExtendA [kind] hi lo y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
hi := v_0
|
||||
lo := v_1
|
||||
y := v_2
|
||||
mem := v_3
|
||||
if !(boundsABI(kind) == 0) {
|
||||
break
|
||||
}
|
||||
v.reset(Op386LoweredPanicExtendA)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.AddArg4(hi, lo, y, mem)
|
||||
return true
|
||||
}
|
||||
// match: (PanicExtend [kind] hi lo y mem)
|
||||
// cond: boundsABI(kind) == 1
|
||||
// result: (LoweredPanicExtendB [kind] hi lo y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
hi := v_0
|
||||
lo := v_1
|
||||
y := v_2
|
||||
mem := v_3
|
||||
if !(boundsABI(kind) == 1) {
|
||||
break
|
||||
}
|
||||
v.reset(Op386LoweredPanicExtendB)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.AddArg4(hi, lo, y, mem)
|
||||
return true
|
||||
}
|
||||
// match: (PanicExtend [kind] hi lo y mem)
|
||||
// cond: boundsABI(kind) == 2
|
||||
// result: (LoweredPanicExtendC [kind] hi lo y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
hi := v_0
|
||||
lo := v_1
|
||||
y := v_2
|
||||
mem := v_3
|
||||
if !(boundsABI(kind) == 2) {
|
||||
break
|
||||
}
|
||||
v.reset(Op386LoweredPanicExtendC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.AddArg4(hi, lo, y, mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValue386_OpRsh16Ux16(v *Value) bool {
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
|
|
|
|||
|
|
@ -215,6 +215,12 @@ func rewriteValueAMD64(v *Value) bool {
|
|||
return rewriteValueAMD64_OpAMD64LEAQ4(v)
|
||||
case OpAMD64LEAQ8:
|
||||
return rewriteValueAMD64_OpAMD64LEAQ8(v)
|
||||
case OpAMD64LoweredPanicBoundsCR:
|
||||
return rewriteValueAMD64_OpAMD64LoweredPanicBoundsCR(v)
|
||||
case OpAMD64LoweredPanicBoundsRC:
|
||||
return rewriteValueAMD64_OpAMD64LoweredPanicBoundsRC(v)
|
||||
case OpAMD64LoweredPanicBoundsRR:
|
||||
return rewriteValueAMD64_OpAMD64LoweredPanicBoundsRR(v)
|
||||
case OpAMD64MOVBELstore:
|
||||
return rewriteValueAMD64_OpAMD64MOVBELstore(v)
|
||||
case OpAMD64MOVBEQstore:
|
||||
|
|
@ -3431,7 +3437,8 @@ func rewriteValueAMD64(v *Value) bool {
|
|||
case OpPairDotProdMaskedInt16x8:
|
||||
return rewriteValueAMD64_OpPairDotProdMaskedInt16x8(v)
|
||||
case OpPanicBounds:
|
||||
return rewriteValueAMD64_OpPanicBounds(v)
|
||||
v.Op = OpAMD64LoweredPanicBoundsRR
|
||||
return true
|
||||
case OpPermute2Float32x16:
|
||||
v.Op = OpAMD64VPERMI2PS512
|
||||
return true
|
||||
|
|
@ -14127,6 +14134,86 @@ func rewriteValueAMD64_OpAMD64LEAQ8(v *Value) bool {
|
|||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueAMD64_OpAMD64LoweredPanicBoundsCR(v *Value) bool {
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (LoweredPanicBoundsCR [kind] {p} (MOVQconst [c]) mem)
|
||||
// result: (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:p.C, Cy:c}} mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
p := auxToPanicBoundsC(v.Aux)
|
||||
if v_0.Op != OpAMD64MOVQconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt64(v_0.AuxInt)
|
||||
mem := v_1
|
||||
v.reset(OpAMD64LoweredPanicBoundsCC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCCToAux(PanicBoundsCC{Cx: p.C, Cy: c})
|
||||
v.AddArg(mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueAMD64_OpAMD64LoweredPanicBoundsRC(v *Value) bool {
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (LoweredPanicBoundsRC [kind] {p} (MOVQconst [c]) mem)
|
||||
// result: (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:c, Cy:p.C}} mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
p := auxToPanicBoundsC(v.Aux)
|
||||
if v_0.Op != OpAMD64MOVQconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt64(v_0.AuxInt)
|
||||
mem := v_1
|
||||
v.reset(OpAMD64LoweredPanicBoundsCC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCCToAux(PanicBoundsCC{Cx: c, Cy: p.C})
|
||||
v.AddArg(mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueAMD64_OpAMD64LoweredPanicBoundsRR(v *Value) bool {
|
||||
v_2 := v.Args[2]
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (LoweredPanicBoundsRR [kind] x (MOVQconst [c]) mem)
|
||||
// result: (LoweredPanicBoundsRC [kind] x {PanicBoundsC{C:c}} mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
x := v_0
|
||||
if v_1.Op != OpAMD64MOVQconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt64(v_1.AuxInt)
|
||||
mem := v_2
|
||||
v.reset(OpAMD64LoweredPanicBoundsRC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCToAux(PanicBoundsC{C: c})
|
||||
v.AddArg2(x, mem)
|
||||
return true
|
||||
}
|
||||
// match: (LoweredPanicBoundsRR [kind] (MOVQconst [c]) y mem)
|
||||
// result: (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:c}} y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
if v_0.Op != OpAMD64MOVQconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt64(v_0.AuxInt)
|
||||
y := v_1
|
||||
mem := v_2
|
||||
v.reset(OpAMD64LoweredPanicBoundsCR)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCToAux(PanicBoundsC{C: c})
|
||||
v.AddArg2(y, mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueAMD64_OpAMD64MOVBELstore(v *Value) bool {
|
||||
v_2 := v.Args[2]
|
||||
v_1 := v.Args[1]
|
||||
|
|
@ -45567,60 +45654,6 @@ func rewriteValueAMD64_OpPairDotProdMaskedInt16x8(v *Value) bool {
|
|||
return true
|
||||
}
|
||||
}
|
||||
func rewriteValueAMD64_OpPanicBounds(v *Value) bool {
|
||||
v_2 := v.Args[2]
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (PanicBounds [kind] x y mem)
|
||||
// cond: boundsABI(kind) == 0
|
||||
// result: (LoweredPanicBoundsA [kind] x y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
x := v_0
|
||||
y := v_1
|
||||
mem := v_2
|
||||
if !(boundsABI(kind) == 0) {
|
||||
break
|
||||
}
|
||||
v.reset(OpAMD64LoweredPanicBoundsA)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.AddArg3(x, y, mem)
|
||||
return true
|
||||
}
|
||||
// match: (PanicBounds [kind] x y mem)
|
||||
// cond: boundsABI(kind) == 1
|
||||
// result: (LoweredPanicBoundsB [kind] x y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
x := v_0
|
||||
y := v_1
|
||||
mem := v_2
|
||||
if !(boundsABI(kind) == 1) {
|
||||
break
|
||||
}
|
||||
v.reset(OpAMD64LoweredPanicBoundsB)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.AddArg3(x, y, mem)
|
||||
return true
|
||||
}
|
||||
// match: (PanicBounds [kind] x y mem)
|
||||
// cond: boundsABI(kind) == 2
|
||||
// result: (LoweredPanicBoundsC [kind] x y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
x := v_0
|
||||
y := v_1
|
||||
mem := v_2
|
||||
if !(boundsABI(kind) == 2) {
|
||||
break
|
||||
}
|
||||
v.reset(OpAMD64LoweredPanicBoundsC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.AddArg3(x, y, mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueAMD64_OpPermute2MaskedFloat32x16(v *Value) bool {
|
||||
v_3 := v.Args[3]
|
||||
v_2 := v.Args[2]
|
||||
|
|
@ -55499,19 +55532,49 @@ func rewriteValueAMD64_OpZero(v *Value) bool {
|
|||
return true
|
||||
}
|
||||
// match: (Zero [s] destptr mem)
|
||||
// cond: s%16 != 0 && s > 16
|
||||
// result: (Zero [s-s%16] (OffPtr <destptr.Type> destptr [s%16]) (MOVOstoreconst [makeValAndOff(0,0)] destptr mem))
|
||||
// cond: s >= 16 && s < 192
|
||||
// result: (LoweredZero [s] destptr mem)
|
||||
for {
|
||||
s := auxIntToInt64(v.AuxInt)
|
||||
destptr := v_0
|
||||
mem := v_1
|
||||
if !(s%16 != 0 && s > 16) {
|
||||
if !(s >= 16 && s < 192) {
|
||||
break
|
||||
}
|
||||
v.reset(OpAMD64LoweredZero)
|
||||
v.AuxInt = int64ToAuxInt(s)
|
||||
v.AddArg2(destptr, mem)
|
||||
return true
|
||||
}
|
||||
// match: (Zero [s] destptr mem)
|
||||
// cond: s >= 192 && s <= repZeroThreshold
|
||||
// result: (LoweredZeroLoop [s] destptr mem)
|
||||
for {
|
||||
s := auxIntToInt64(v.AuxInt)
|
||||
destptr := v_0
|
||||
mem := v_1
|
||||
if !(s >= 192 && s <= repZeroThreshold) {
|
||||
break
|
||||
}
|
||||
v.reset(OpAMD64LoweredZeroLoop)
|
||||
v.AuxInt = int64ToAuxInt(s)
|
||||
v.AddArg2(destptr, mem)
|
||||
return true
|
||||
}
|
||||
// match: (Zero [s] destptr mem)
|
||||
// cond: s > repZeroThreshold && s%8 != 0
|
||||
// result: (Zero [s-s%8] (OffPtr <destptr.Type> destptr [s%8]) (MOVOstoreconst [makeValAndOff(0,0)] destptr mem))
|
||||
for {
|
||||
s := auxIntToInt64(v.AuxInt)
|
||||
destptr := v_0
|
||||
mem := v_1
|
||||
if !(s > repZeroThreshold && s%8 != 0) {
|
||||
break
|
||||
}
|
||||
v.reset(OpZero)
|
||||
v.AuxInt = int64ToAuxInt(s - s%16)
|
||||
v.AuxInt = int64ToAuxInt(s - s%8)
|
||||
v0 := b.NewValue0(v.Pos, OpOffPtr, destptr.Type)
|
||||
v0.AuxInt = int64ToAuxInt(s % 16)
|
||||
v0.AuxInt = int64ToAuxInt(s % 8)
|
||||
v0.AddArg(destptr)
|
||||
v1 := b.NewValue0(v.Pos, OpAMD64MOVOstoreconst, types.TypeMem)
|
||||
v1.AuxInt = valAndOffToAuxInt(makeValAndOff(0, 0))
|
||||
|
|
@ -55519,99 +55582,14 @@ func rewriteValueAMD64_OpZero(v *Value) bool {
|
|||
v.AddArg2(v0, v1)
|
||||
return true
|
||||
}
|
||||
// match: (Zero [16] destptr mem)
|
||||
// result: (MOVOstoreconst [makeValAndOff(0,0)] destptr mem)
|
||||
for {
|
||||
if auxIntToInt64(v.AuxInt) != 16 {
|
||||
break
|
||||
}
|
||||
destptr := v_0
|
||||
mem := v_1
|
||||
v.reset(OpAMD64MOVOstoreconst)
|
||||
v.AuxInt = valAndOffToAuxInt(makeValAndOff(0, 0))
|
||||
v.AddArg2(destptr, mem)
|
||||
return true
|
||||
}
|
||||
// match: (Zero [32] destptr mem)
|
||||
// result: (MOVOstoreconst [makeValAndOff(0,16)] destptr (MOVOstoreconst [makeValAndOff(0,0)] destptr mem))
|
||||
for {
|
||||
if auxIntToInt64(v.AuxInt) != 32 {
|
||||
break
|
||||
}
|
||||
destptr := v_0
|
||||
mem := v_1
|
||||
v.reset(OpAMD64MOVOstoreconst)
|
||||
v.AuxInt = valAndOffToAuxInt(makeValAndOff(0, 16))
|
||||
v0 := b.NewValue0(v.Pos, OpAMD64MOVOstoreconst, types.TypeMem)
|
||||
v0.AuxInt = valAndOffToAuxInt(makeValAndOff(0, 0))
|
||||
v0.AddArg2(destptr, mem)
|
||||
v.AddArg2(destptr, v0)
|
||||
return true
|
||||
}
|
||||
// match: (Zero [48] destptr mem)
|
||||
// result: (MOVOstoreconst [makeValAndOff(0,32)] destptr (MOVOstoreconst [makeValAndOff(0,16)] destptr (MOVOstoreconst [makeValAndOff(0,0)] destptr mem)))
|
||||
for {
|
||||
if auxIntToInt64(v.AuxInt) != 48 {
|
||||
break
|
||||
}
|
||||
destptr := v_0
|
||||
mem := v_1
|
||||
v.reset(OpAMD64MOVOstoreconst)
|
||||
v.AuxInt = valAndOffToAuxInt(makeValAndOff(0, 32))
|
||||
v0 := b.NewValue0(v.Pos, OpAMD64MOVOstoreconst, types.TypeMem)
|
||||
v0.AuxInt = valAndOffToAuxInt(makeValAndOff(0, 16))
|
||||
v1 := b.NewValue0(v.Pos, OpAMD64MOVOstoreconst, types.TypeMem)
|
||||
v1.AuxInt = valAndOffToAuxInt(makeValAndOff(0, 0))
|
||||
v1.AddArg2(destptr, mem)
|
||||
v0.AddArg2(destptr, v1)
|
||||
v.AddArg2(destptr, v0)
|
||||
return true
|
||||
}
|
||||
// match: (Zero [64] destptr mem)
|
||||
// result: (MOVOstoreconst [makeValAndOff(0,48)] destptr (MOVOstoreconst [makeValAndOff(0,32)] destptr (MOVOstoreconst [makeValAndOff(0,16)] destptr (MOVOstoreconst [makeValAndOff(0,0)] destptr mem))))
|
||||
for {
|
||||
if auxIntToInt64(v.AuxInt) != 64 {
|
||||
break
|
||||
}
|
||||
destptr := v_0
|
||||
mem := v_1
|
||||
v.reset(OpAMD64MOVOstoreconst)
|
||||
v.AuxInt = valAndOffToAuxInt(makeValAndOff(0, 48))
|
||||
v0 := b.NewValue0(v.Pos, OpAMD64MOVOstoreconst, types.TypeMem)
|
||||
v0.AuxInt = valAndOffToAuxInt(makeValAndOff(0, 32))
|
||||
v1 := b.NewValue0(v.Pos, OpAMD64MOVOstoreconst, types.TypeMem)
|
||||
v1.AuxInt = valAndOffToAuxInt(makeValAndOff(0, 16))
|
||||
v2 := b.NewValue0(v.Pos, OpAMD64MOVOstoreconst, types.TypeMem)
|
||||
v2.AuxInt = valAndOffToAuxInt(makeValAndOff(0, 0))
|
||||
v2.AddArg2(destptr, mem)
|
||||
v1.AddArg2(destptr, v2)
|
||||
v0.AddArg2(destptr, v1)
|
||||
v.AddArg2(destptr, v0)
|
||||
return true
|
||||
}
|
||||
// match: (Zero [s] destptr mem)
|
||||
// cond: s > 64 && s <= 1024 && s%16 == 0
|
||||
// result: (DUFFZERO [s] destptr mem)
|
||||
for {
|
||||
s := auxIntToInt64(v.AuxInt)
|
||||
destptr := v_0
|
||||
mem := v_1
|
||||
if !(s > 64 && s <= 1024 && s%16 == 0) {
|
||||
break
|
||||
}
|
||||
v.reset(OpAMD64DUFFZERO)
|
||||
v.AuxInt = int64ToAuxInt(s)
|
||||
v.AddArg2(destptr, mem)
|
||||
return true
|
||||
}
|
||||
// match: (Zero [s] destptr mem)
|
||||
// cond: s > 1024 && s%8 == 0
|
||||
// cond: s > repZeroThreshold && s%8 == 0
|
||||
// result: (REPSTOSQ destptr (MOVQconst [s/8]) (MOVQconst [0]) mem)
|
||||
for {
|
||||
s := auxIntToInt64(v.AuxInt)
|
||||
destptr := v_0
|
||||
mem := v_1
|
||||
if !(s > 1024 && s%8 == 0) {
|
||||
if !(s > repZeroThreshold && s%8 == 0) {
|
||||
break
|
||||
}
|
||||
v.reset(OpAMD64REPSTOSQ)
|
||||
|
|
|
|||
|
|
@ -151,6 +151,14 @@ func rewriteValueARM(v *Value) bool {
|
|||
return rewriteValueARM_OpARMLessThan(v)
|
||||
case OpARMLessThanU:
|
||||
return rewriteValueARM_OpARMLessThanU(v)
|
||||
case OpARMLoweredPanicBoundsRC:
|
||||
return rewriteValueARM_OpARMLoweredPanicBoundsRC(v)
|
||||
case OpARMLoweredPanicBoundsRR:
|
||||
return rewriteValueARM_OpARMLoweredPanicBoundsRR(v)
|
||||
case OpARMLoweredPanicExtendRC:
|
||||
return rewriteValueARM_OpARMLoweredPanicExtendRC(v)
|
||||
case OpARMLoweredPanicExtendRR:
|
||||
return rewriteValueARM_OpARMLoweredPanicExtendRR(v)
|
||||
case OpARMMOVBUload:
|
||||
return rewriteValueARM_OpARMMOVBUload(v)
|
||||
case OpARMMOVBUloadidx:
|
||||
|
|
@ -745,9 +753,11 @@ func rewriteValueARM(v *Value) bool {
|
|||
v.Op = OpARMOR
|
||||
return true
|
||||
case OpPanicBounds:
|
||||
return rewriteValueARM_OpPanicBounds(v)
|
||||
v.Op = OpARMLoweredPanicBoundsRR
|
||||
return true
|
||||
case OpPanicExtend:
|
||||
return rewriteValueARM_OpPanicExtend(v)
|
||||
v.Op = OpARMLoweredPanicExtendRR
|
||||
return true
|
||||
case OpRotateLeft16:
|
||||
return rewriteValueARM_OpRotateLeft16(v)
|
||||
case OpRotateLeft32:
|
||||
|
|
@ -4548,6 +4558,135 @@ func rewriteValueARM_OpARMLessThanU(v *Value) bool {
|
|||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueARM_OpARMLoweredPanicBoundsRC(v *Value) bool {
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (LoweredPanicBoundsRC [kind] {p} (MOVWconst [c]) mem)
|
||||
// result: (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:int64(c), Cy:p.C}} mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
p := auxToPanicBoundsC(v.Aux)
|
||||
if v_0.Op != OpARMMOVWconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt32(v_0.AuxInt)
|
||||
mem := v_1
|
||||
v.reset(OpARMLoweredPanicBoundsCC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCCToAux(PanicBoundsCC{Cx: int64(c), Cy: p.C})
|
||||
v.AddArg(mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueARM_OpARMLoweredPanicBoundsRR(v *Value) bool {
|
||||
v_2 := v.Args[2]
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (LoweredPanicBoundsRR [kind] x (MOVWconst [c]) mem)
|
||||
// result: (LoweredPanicBoundsRC [kind] x {PanicBoundsC{C:int64(c)}} mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
x := v_0
|
||||
if v_1.Op != OpARMMOVWconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt32(v_1.AuxInt)
|
||||
mem := v_2
|
||||
v.reset(OpARMLoweredPanicBoundsRC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCToAux(PanicBoundsC{C: int64(c)})
|
||||
v.AddArg2(x, mem)
|
||||
return true
|
||||
}
|
||||
// match: (LoweredPanicBoundsRR [kind] (MOVWconst [c]) y mem)
|
||||
// result: (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:int64(c)}} y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
if v_0.Op != OpARMMOVWconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt32(v_0.AuxInt)
|
||||
y := v_1
|
||||
mem := v_2
|
||||
v.reset(OpARMLoweredPanicBoundsCR)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCToAux(PanicBoundsC{C: int64(c)})
|
||||
v.AddArg2(y, mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueARM_OpARMLoweredPanicExtendRC(v *Value) bool {
|
||||
v_2 := v.Args[2]
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (LoweredPanicExtendRC [kind] {p} (MOVWconst [hi]) (MOVWconst [lo]) mem)
|
||||
// result: (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:int64(hi)<<32+int64(uint32(lo)), Cy:p.C}} mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
p := auxToPanicBoundsC(v.Aux)
|
||||
if v_0.Op != OpARMMOVWconst {
|
||||
break
|
||||
}
|
||||
hi := auxIntToInt32(v_0.AuxInt)
|
||||
if v_1.Op != OpARMMOVWconst {
|
||||
break
|
||||
}
|
||||
lo := auxIntToInt32(v_1.AuxInt)
|
||||
mem := v_2
|
||||
v.reset(OpARMLoweredPanicBoundsCC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCCToAux(PanicBoundsCC{Cx: int64(hi)<<32 + int64(uint32(lo)), Cy: p.C})
|
||||
v.AddArg(mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueARM_OpARMLoweredPanicExtendRR(v *Value) bool {
|
||||
v_3 := v.Args[3]
|
||||
v_2 := v.Args[2]
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (LoweredPanicExtendRR [kind] hi lo (MOVWconst [c]) mem)
|
||||
// result: (LoweredPanicExtendRC [kind] hi lo {PanicBoundsC{C:int64(c)}} mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
hi := v_0
|
||||
lo := v_1
|
||||
if v_2.Op != OpARMMOVWconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt32(v_2.AuxInt)
|
||||
mem := v_3
|
||||
v.reset(OpARMLoweredPanicExtendRC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCToAux(PanicBoundsC{C: int64(c)})
|
||||
v.AddArg3(hi, lo, mem)
|
||||
return true
|
||||
}
|
||||
// match: (LoweredPanicExtendRR [kind] (MOVWconst [hi]) (MOVWconst [lo]) y mem)
|
||||
// result: (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:int64(hi)<<32 + int64(uint32(lo))}} y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
if v_0.Op != OpARMMOVWconst {
|
||||
break
|
||||
}
|
||||
hi := auxIntToInt32(v_0.AuxInt)
|
||||
if v_1.Op != OpARMMOVWconst {
|
||||
break
|
||||
}
|
||||
lo := auxIntToInt32(v_1.AuxInt)
|
||||
y := v_2
|
||||
mem := v_3
|
||||
v.reset(OpARMLoweredPanicBoundsCR)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCToAux(PanicBoundsC{C: int64(hi)<<32 + int64(uint32(lo))})
|
||||
v.AddArg2(y, mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueARM_OpARMMOVBUload(v *Value) bool {
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
|
|
@ -14969,118 +15108,6 @@ func rewriteValueARM_OpOffPtr(v *Value) bool {
|
|||
return true
|
||||
}
|
||||
}
|
||||
func rewriteValueARM_OpPanicBounds(v *Value) bool {
|
||||
v_2 := v.Args[2]
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (PanicBounds [kind] x y mem)
|
||||
// cond: boundsABI(kind) == 0
|
||||
// result: (LoweredPanicBoundsA [kind] x y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
x := v_0
|
||||
y := v_1
|
||||
mem := v_2
|
||||
if !(boundsABI(kind) == 0) {
|
||||
break
|
||||
}
|
||||
v.reset(OpARMLoweredPanicBoundsA)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.AddArg3(x, y, mem)
|
||||
return true
|
||||
}
|
||||
// match: (PanicBounds [kind] x y mem)
|
||||
// cond: boundsABI(kind) == 1
|
||||
// result: (LoweredPanicBoundsB [kind] x y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
x := v_0
|
||||
y := v_1
|
||||
mem := v_2
|
||||
if !(boundsABI(kind) == 1) {
|
||||
break
|
||||
}
|
||||
v.reset(OpARMLoweredPanicBoundsB)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.AddArg3(x, y, mem)
|
||||
return true
|
||||
}
|
||||
// match: (PanicBounds [kind] x y mem)
|
||||
// cond: boundsABI(kind) == 2
|
||||
// result: (LoweredPanicBoundsC [kind] x y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
x := v_0
|
||||
y := v_1
|
||||
mem := v_2
|
||||
if !(boundsABI(kind) == 2) {
|
||||
break
|
||||
}
|
||||
v.reset(OpARMLoweredPanicBoundsC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.AddArg3(x, y, mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueARM_OpPanicExtend(v *Value) bool {
|
||||
v_3 := v.Args[3]
|
||||
v_2 := v.Args[2]
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (PanicExtend [kind] hi lo y mem)
|
||||
// cond: boundsABI(kind) == 0
|
||||
// result: (LoweredPanicExtendA [kind] hi lo y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
hi := v_0
|
||||
lo := v_1
|
||||
y := v_2
|
||||
mem := v_3
|
||||
if !(boundsABI(kind) == 0) {
|
||||
break
|
||||
}
|
||||
v.reset(OpARMLoweredPanicExtendA)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.AddArg4(hi, lo, y, mem)
|
||||
return true
|
||||
}
|
||||
// match: (PanicExtend [kind] hi lo y mem)
|
||||
// cond: boundsABI(kind) == 1
|
||||
// result: (LoweredPanicExtendB [kind] hi lo y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
hi := v_0
|
||||
lo := v_1
|
||||
y := v_2
|
||||
mem := v_3
|
||||
if !(boundsABI(kind) == 1) {
|
||||
break
|
||||
}
|
||||
v.reset(OpARMLoweredPanicExtendB)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.AddArg4(hi, lo, y, mem)
|
||||
return true
|
||||
}
|
||||
// match: (PanicExtend [kind] hi lo y mem)
|
||||
// cond: boundsABI(kind) == 2
|
||||
// result: (LoweredPanicExtendC [kind] hi lo y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
hi := v_0
|
||||
lo := v_1
|
||||
y := v_2
|
||||
mem := v_3
|
||||
if !(boundsABI(kind) == 2) {
|
||||
break
|
||||
}
|
||||
v.reset(OpARMLoweredPanicExtendC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.AddArg4(hi, lo, y, mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueARM_OpRotateLeft16(v *Value) bool {
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
|
|
|
|||
|
|
@ -180,6 +180,12 @@ func rewriteValueARM64(v *Value) bool {
|
|||
return rewriteValueARM64_OpARM64LessThanNoov(v)
|
||||
case OpARM64LessThanU:
|
||||
return rewriteValueARM64_OpARM64LessThanU(v)
|
||||
case OpARM64LoweredPanicBoundsCR:
|
||||
return rewriteValueARM64_OpARM64LoweredPanicBoundsCR(v)
|
||||
case OpARM64LoweredPanicBoundsRC:
|
||||
return rewriteValueARM64_OpARM64LoweredPanicBoundsRC(v)
|
||||
case OpARM64LoweredPanicBoundsRR:
|
||||
return rewriteValueARM64_OpARM64LoweredPanicBoundsRR(v)
|
||||
case OpARM64MADD:
|
||||
return rewriteValueARM64_OpARM64MADD(v)
|
||||
case OpARM64MADDW:
|
||||
|
|
@ -936,7 +942,8 @@ func rewriteValueARM64(v *Value) bool {
|
|||
v.Op = OpARM64OR
|
||||
return true
|
||||
case OpPanicBounds:
|
||||
return rewriteValueARM64_OpPanicBounds(v)
|
||||
v.Op = OpARM64LoweredPanicBoundsRR
|
||||
return true
|
||||
case OpPopCount16:
|
||||
return rewriteValueARM64_OpPopCount16(v)
|
||||
case OpPopCount32:
|
||||
|
|
@ -1592,6 +1599,66 @@ func rewriteValueARM64_OpARM64ADD(v *Value) bool {
|
|||
}
|
||||
break
|
||||
}
|
||||
// match: (ADD x0 x1:(ANDshiftRA x2:(SLLconst [sl] y) z [63]))
|
||||
// cond: x1.Uses == 1 && x2.Uses == 1
|
||||
// result: (ADDshiftLL x0 (ANDshiftRA <y.Type> y z [63]) [sl])
|
||||
for {
|
||||
for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
|
||||
x0 := v_0
|
||||
x1 := v_1
|
||||
if x1.Op != OpARM64ANDshiftRA || auxIntToInt64(x1.AuxInt) != 63 {
|
||||
continue
|
||||
}
|
||||
z := x1.Args[1]
|
||||
x2 := x1.Args[0]
|
||||
if x2.Op != OpARM64SLLconst {
|
||||
continue
|
||||
}
|
||||
sl := auxIntToInt64(x2.AuxInt)
|
||||
y := x2.Args[0]
|
||||
if !(x1.Uses == 1 && x2.Uses == 1) {
|
||||
continue
|
||||
}
|
||||
v.reset(OpARM64ADDshiftLL)
|
||||
v.AuxInt = int64ToAuxInt(sl)
|
||||
v0 := b.NewValue0(v.Pos, OpARM64ANDshiftRA, y.Type)
|
||||
v0.AuxInt = int64ToAuxInt(63)
|
||||
v0.AddArg2(y, z)
|
||||
v.AddArg2(x0, v0)
|
||||
return true
|
||||
}
|
||||
break
|
||||
}
|
||||
// match: (ADD x0 x1:(ANDshiftLL x2:(SRAconst [63] z) y [sl]))
|
||||
// cond: x1.Uses == 1 && x2.Uses == 1
|
||||
// result: (ADDshiftLL x0 (ANDshiftRA <y.Type> y z [63]) [sl])
|
||||
for {
|
||||
for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
|
||||
x0 := v_0
|
||||
x1 := v_1
|
||||
if x1.Op != OpARM64ANDshiftLL {
|
||||
continue
|
||||
}
|
||||
sl := auxIntToInt64(x1.AuxInt)
|
||||
y := x1.Args[1]
|
||||
x2 := x1.Args[0]
|
||||
if x2.Op != OpARM64SRAconst || auxIntToInt64(x2.AuxInt) != 63 {
|
||||
continue
|
||||
}
|
||||
z := x2.Args[0]
|
||||
if !(x1.Uses == 1 && x2.Uses == 1) {
|
||||
continue
|
||||
}
|
||||
v.reset(OpARM64ADDshiftLL)
|
||||
v.AuxInt = int64ToAuxInt(sl)
|
||||
v0 := b.NewValue0(v.Pos, OpARM64ANDshiftRA, y.Type)
|
||||
v0.AuxInt = int64ToAuxInt(63)
|
||||
v0.AddArg2(y, z)
|
||||
v.AddArg2(x0, v0)
|
||||
return true
|
||||
}
|
||||
break
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueARM64_OpARM64ADDSflags(v *Value) bool {
|
||||
|
|
@ -6982,6 +7049,86 @@ func rewriteValueARM64_OpARM64LessThanU(v *Value) bool {
|
|||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueARM64_OpARM64LoweredPanicBoundsCR(v *Value) bool {
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (LoweredPanicBoundsCR [kind] {p} (MOVDconst [c]) mem)
|
||||
// result: (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:p.C, Cy:c}} mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
p := auxToPanicBoundsC(v.Aux)
|
||||
if v_0.Op != OpARM64MOVDconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt64(v_0.AuxInt)
|
||||
mem := v_1
|
||||
v.reset(OpARM64LoweredPanicBoundsCC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCCToAux(PanicBoundsCC{Cx: p.C, Cy: c})
|
||||
v.AddArg(mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueARM64_OpARM64LoweredPanicBoundsRC(v *Value) bool {
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (LoweredPanicBoundsRC [kind] {p} (MOVDconst [c]) mem)
|
||||
// result: (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:c, Cy:p.C}} mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
p := auxToPanicBoundsC(v.Aux)
|
||||
if v_0.Op != OpARM64MOVDconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt64(v_0.AuxInt)
|
||||
mem := v_1
|
||||
v.reset(OpARM64LoweredPanicBoundsCC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCCToAux(PanicBoundsCC{Cx: c, Cy: p.C})
|
||||
v.AddArg(mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueARM64_OpARM64LoweredPanicBoundsRR(v *Value) bool {
|
||||
v_2 := v.Args[2]
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (LoweredPanicBoundsRR [kind] x (MOVDconst [c]) mem)
|
||||
// result: (LoweredPanicBoundsRC [kind] x {PanicBoundsC{C:c}} mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
x := v_0
|
||||
if v_1.Op != OpARM64MOVDconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt64(v_1.AuxInt)
|
||||
mem := v_2
|
||||
v.reset(OpARM64LoweredPanicBoundsRC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCToAux(PanicBoundsC{C: c})
|
||||
v.AddArg2(x, mem)
|
||||
return true
|
||||
}
|
||||
// match: (LoweredPanicBoundsRR [kind] (MOVDconst [c]) y mem)
|
||||
// result: (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:c}} y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
if v_0.Op != OpARM64MOVDconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt64(v_0.AuxInt)
|
||||
y := v_1
|
||||
mem := v_2
|
||||
v.reset(OpARM64LoweredPanicBoundsCR)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCToAux(PanicBoundsC{C: c})
|
||||
v.AddArg2(y, mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueARM64_OpARM64MADD(v *Value) bool {
|
||||
v_2 := v.Args[2]
|
||||
v_1 := v.Args[1]
|
||||
|
|
@ -19790,60 +19937,6 @@ func rewriteValueARM64_OpOffPtr(v *Value) bool {
|
|||
return true
|
||||
}
|
||||
}
|
||||
func rewriteValueARM64_OpPanicBounds(v *Value) bool {
|
||||
v_2 := v.Args[2]
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (PanicBounds [kind] x y mem)
|
||||
// cond: boundsABI(kind) == 0
|
||||
// result: (LoweredPanicBoundsA [kind] x y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
x := v_0
|
||||
y := v_1
|
||||
mem := v_2
|
||||
if !(boundsABI(kind) == 0) {
|
||||
break
|
||||
}
|
||||
v.reset(OpARM64LoweredPanicBoundsA)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.AddArg3(x, y, mem)
|
||||
return true
|
||||
}
|
||||
// match: (PanicBounds [kind] x y mem)
|
||||
// cond: boundsABI(kind) == 1
|
||||
// result: (LoweredPanicBoundsB [kind] x y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
x := v_0
|
||||
y := v_1
|
||||
mem := v_2
|
||||
if !(boundsABI(kind) == 1) {
|
||||
break
|
||||
}
|
||||
v.reset(OpARM64LoweredPanicBoundsB)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.AddArg3(x, y, mem)
|
||||
return true
|
||||
}
|
||||
// match: (PanicBounds [kind] x y mem)
|
||||
// cond: boundsABI(kind) == 2
|
||||
// result: (LoweredPanicBoundsC [kind] x y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
x := v_0
|
||||
y := v_1
|
||||
mem := v_2
|
||||
if !(boundsABI(kind) == 2) {
|
||||
break
|
||||
}
|
||||
v.reset(OpARM64LoweredPanicBoundsC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.AddArg3(x, y, mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueARM64_OpPopCount16(v *Value) bool {
|
||||
v_0 := v.Args[0]
|
||||
b := v.Block
|
||||
|
|
@ -25045,6 +25138,37 @@ func rewriteBlockARM64(b *Block) bool {
|
|||
b.resetWithControl(BlockARM64FGE, cc)
|
||||
return true
|
||||
}
|
||||
// match: (NZ sub:(SUB x y))
|
||||
// cond: sub.Uses == 1
|
||||
// result: (NE (CMP x y))
|
||||
for b.Controls[0].Op == OpARM64SUB {
|
||||
sub := b.Controls[0]
|
||||
y := sub.Args[1]
|
||||
x := sub.Args[0]
|
||||
if !(sub.Uses == 1) {
|
||||
break
|
||||
}
|
||||
v0 := b.NewValue0(sub.Pos, OpARM64CMP, types.TypeFlags)
|
||||
v0.AddArg2(x, y)
|
||||
b.resetWithControl(BlockARM64NE, v0)
|
||||
return true
|
||||
}
|
||||
// match: (NZ sub:(SUBconst [c] y))
|
||||
// cond: sub.Uses == 1
|
||||
// result: (NE (CMPconst [c] y))
|
||||
for b.Controls[0].Op == OpARM64SUBconst {
|
||||
sub := b.Controls[0]
|
||||
c := auxIntToInt64(sub.AuxInt)
|
||||
y := sub.Args[0]
|
||||
if !(sub.Uses == 1) {
|
||||
break
|
||||
}
|
||||
v0 := b.NewValue0(sub.Pos, OpARM64CMPconst, types.TypeFlags)
|
||||
v0.AuxInt = int64ToAuxInt(c)
|
||||
v0.AddArg(y)
|
||||
b.resetWithControl(BlockARM64NE, v0)
|
||||
return true
|
||||
}
|
||||
// match: (NZ (ANDconst [c] x) yes no)
|
||||
// cond: oneBit(c)
|
||||
// result: (TBNZ [int64(ntz64(c))] x yes no)
|
||||
|
|
@ -25083,6 +25207,37 @@ func rewriteBlockARM64(b *Block) bool {
|
|||
return true
|
||||
}
|
||||
case BlockARM64NZW:
|
||||
// match: (NZW sub:(SUB x y))
|
||||
// cond: sub.Uses == 1
|
||||
// result: (NE (CMPW x y))
|
||||
for b.Controls[0].Op == OpARM64SUB {
|
||||
sub := b.Controls[0]
|
||||
y := sub.Args[1]
|
||||
x := sub.Args[0]
|
||||
if !(sub.Uses == 1) {
|
||||
break
|
||||
}
|
||||
v0 := b.NewValue0(sub.Pos, OpARM64CMPW, types.TypeFlags)
|
||||
v0.AddArg2(x, y)
|
||||
b.resetWithControl(BlockARM64NE, v0)
|
||||
return true
|
||||
}
|
||||
// match: (NZW sub:(SUBconst [c] y))
|
||||
// cond: sub.Uses == 1
|
||||
// result: (NE (CMPWconst [int32(c)] y))
|
||||
for b.Controls[0].Op == OpARM64SUBconst {
|
||||
sub := b.Controls[0]
|
||||
c := auxIntToInt64(sub.AuxInt)
|
||||
y := sub.Args[0]
|
||||
if !(sub.Uses == 1) {
|
||||
break
|
||||
}
|
||||
v0 := b.NewValue0(sub.Pos, OpARM64CMPWconst, types.TypeFlags)
|
||||
v0.AuxInt = int32ToAuxInt(int32(c))
|
||||
v0.AddArg(y)
|
||||
b.resetWithControl(BlockARM64NE, v0)
|
||||
return true
|
||||
}
|
||||
// match: (NZW (ANDconst [c] x) yes no)
|
||||
// cond: oneBit(int64(uint32(c)))
|
||||
// result: (TBNZ [int64(ntz64(int64(uint32(c))))] x yes no)
|
||||
|
|
@ -25312,6 +25467,34 @@ func rewriteBlockARM64(b *Block) bool {
|
|||
return true
|
||||
}
|
||||
case BlockARM64UGT:
|
||||
// match: (UGT (CMPconst [0] x))
|
||||
// result: (NE (CMPconst [0] x))
|
||||
for b.Controls[0].Op == OpARM64CMPconst {
|
||||
v_0 := b.Controls[0]
|
||||
if auxIntToInt64(v_0.AuxInt) != 0 {
|
||||
break
|
||||
}
|
||||
x := v_0.Args[0]
|
||||
v0 := b.NewValue0(v_0.Pos, OpARM64CMPconst, types.TypeFlags)
|
||||
v0.AuxInt = int64ToAuxInt(0)
|
||||
v0.AddArg(x)
|
||||
b.resetWithControl(BlockARM64NE, v0)
|
||||
return true
|
||||
}
|
||||
// match: (UGT (CMPWconst [0] x))
|
||||
// result: (NE (CMPWconst [0] x))
|
||||
for b.Controls[0].Op == OpARM64CMPWconst {
|
||||
v_0 := b.Controls[0]
|
||||
if auxIntToInt32(v_0.AuxInt) != 0 {
|
||||
break
|
||||
}
|
||||
x := v_0.Args[0]
|
||||
v0 := b.NewValue0(v_0.Pos, OpARM64CMPWconst, types.TypeFlags)
|
||||
v0.AuxInt = int32ToAuxInt(0)
|
||||
v0.AddArg(x)
|
||||
b.resetWithControl(BlockARM64NE, v0)
|
||||
return true
|
||||
}
|
||||
// match: (UGT (FlagConstant [fc]) yes no)
|
||||
// cond: fc.ugt()
|
||||
// result: (First yes no)
|
||||
|
|
@ -25346,6 +25529,34 @@ func rewriteBlockARM64(b *Block) bool {
|
|||
return true
|
||||
}
|
||||
case BlockARM64ULE:
|
||||
// match: (ULE (CMPconst [0] x))
|
||||
// result: (EQ (CMPconst [0] x))
|
||||
for b.Controls[0].Op == OpARM64CMPconst {
|
||||
v_0 := b.Controls[0]
|
||||
if auxIntToInt64(v_0.AuxInt) != 0 {
|
||||
break
|
||||
}
|
||||
x := v_0.Args[0]
|
||||
v0 := b.NewValue0(v_0.Pos, OpARM64CMPconst, types.TypeFlags)
|
||||
v0.AuxInt = int64ToAuxInt(0)
|
||||
v0.AddArg(x)
|
||||
b.resetWithControl(BlockARM64EQ, v0)
|
||||
return true
|
||||
}
|
||||
// match: (ULE (CMPWconst [0] x))
|
||||
// result: (EQ (CMPWconst [0] x))
|
||||
for b.Controls[0].Op == OpARM64CMPWconst {
|
||||
v_0 := b.Controls[0]
|
||||
if auxIntToInt32(v_0.AuxInt) != 0 {
|
||||
break
|
||||
}
|
||||
x := v_0.Args[0]
|
||||
v0 := b.NewValue0(v_0.Pos, OpARM64CMPWconst, types.TypeFlags)
|
||||
v0.AuxInt = int32ToAuxInt(0)
|
||||
v0.AddArg(x)
|
||||
b.resetWithControl(BlockARM64EQ, v0)
|
||||
return true
|
||||
}
|
||||
// match: (ULE (FlagConstant [fc]) yes no)
|
||||
// cond: fc.ule()
|
||||
// result: (First yes no)
|
||||
|
|
@ -25414,6 +25625,37 @@ func rewriteBlockARM64(b *Block) bool {
|
|||
return true
|
||||
}
|
||||
case BlockARM64Z:
|
||||
// match: (Z sub:(SUB x y))
|
||||
// cond: sub.Uses == 1
|
||||
// result: (EQ (CMP x y))
|
||||
for b.Controls[0].Op == OpARM64SUB {
|
||||
sub := b.Controls[0]
|
||||
y := sub.Args[1]
|
||||
x := sub.Args[0]
|
||||
if !(sub.Uses == 1) {
|
||||
break
|
||||
}
|
||||
v0 := b.NewValue0(sub.Pos, OpARM64CMP, types.TypeFlags)
|
||||
v0.AddArg2(x, y)
|
||||
b.resetWithControl(BlockARM64EQ, v0)
|
||||
return true
|
||||
}
|
||||
// match: (Z sub:(SUBconst [c] y))
|
||||
// cond: sub.Uses == 1
|
||||
// result: (EQ (CMPconst [c] y))
|
||||
for b.Controls[0].Op == OpARM64SUBconst {
|
||||
sub := b.Controls[0]
|
||||
c := auxIntToInt64(sub.AuxInt)
|
||||
y := sub.Args[0]
|
||||
if !(sub.Uses == 1) {
|
||||
break
|
||||
}
|
||||
v0 := b.NewValue0(sub.Pos, OpARM64CMPconst, types.TypeFlags)
|
||||
v0.AuxInt = int64ToAuxInt(c)
|
||||
v0.AddArg(y)
|
||||
b.resetWithControl(BlockARM64EQ, v0)
|
||||
return true
|
||||
}
|
||||
// match: (Z (ANDconst [c] x) yes no)
|
||||
// cond: oneBit(c)
|
||||
// result: (TBZ [int64(ntz64(c))] x yes no)
|
||||
|
|
@ -25452,6 +25694,37 @@ func rewriteBlockARM64(b *Block) bool {
|
|||
return true
|
||||
}
|
||||
case BlockARM64ZW:
|
||||
// match: (ZW sub:(SUB x y))
|
||||
// cond: sub.Uses == 1
|
||||
// result: (EQ (CMPW x y))
|
||||
for b.Controls[0].Op == OpARM64SUB {
|
||||
sub := b.Controls[0]
|
||||
y := sub.Args[1]
|
||||
x := sub.Args[0]
|
||||
if !(sub.Uses == 1) {
|
||||
break
|
||||
}
|
||||
v0 := b.NewValue0(sub.Pos, OpARM64CMPW, types.TypeFlags)
|
||||
v0.AddArg2(x, y)
|
||||
b.resetWithControl(BlockARM64EQ, v0)
|
||||
return true
|
||||
}
|
||||
// match: (ZW sub:(SUBconst [c] y))
|
||||
// cond: sub.Uses == 1
|
||||
// result: (EQ (CMPWconst [int32(c)] y))
|
||||
for b.Controls[0].Op == OpARM64SUBconst {
|
||||
sub := b.Controls[0]
|
||||
c := auxIntToInt64(sub.AuxInt)
|
||||
y := sub.Args[0]
|
||||
if !(sub.Uses == 1) {
|
||||
break
|
||||
}
|
||||
v0 := b.NewValue0(sub.Pos, OpARM64CMPWconst, types.TypeFlags)
|
||||
v0.AuxInt = int32ToAuxInt(int32(c))
|
||||
v0.AddArg(y)
|
||||
b.resetWithControl(BlockARM64EQ, v0)
|
||||
return true
|
||||
}
|
||||
// match: (ZW (ANDconst [c] x) yes no)
|
||||
// cond: oneBit(int64(uint32(c)))
|
||||
// result: (TBZ [int64(ntz64(int64(uint32(c))))] x yes no)
|
||||
|
|
|
|||
|
|
@ -330,6 +330,12 @@ func rewriteValueLOONG64(v *Value) bool {
|
|||
return rewriteValueLOONG64_OpLOONG64DIVV(v)
|
||||
case OpLOONG64DIVVU:
|
||||
return rewriteValueLOONG64_OpLOONG64DIVVU(v)
|
||||
case OpLOONG64LoweredPanicBoundsCR:
|
||||
return rewriteValueLOONG64_OpLOONG64LoweredPanicBoundsCR(v)
|
||||
case OpLOONG64LoweredPanicBoundsRC:
|
||||
return rewriteValueLOONG64_OpLOONG64LoweredPanicBoundsRC(v)
|
||||
case OpLOONG64LoweredPanicBoundsRR:
|
||||
return rewriteValueLOONG64_OpLOONG64LoweredPanicBoundsRR(v)
|
||||
case OpLOONG64MASKEQZ:
|
||||
return rewriteValueLOONG64_OpLOONG64MASKEQZ(v)
|
||||
case OpLOONG64MASKNEZ:
|
||||
|
|
@ -669,7 +675,8 @@ func rewriteValueLOONG64(v *Value) bool {
|
|||
v.Op = OpLOONG64OR
|
||||
return true
|
||||
case OpPanicBounds:
|
||||
return rewriteValueLOONG64_OpPanicBounds(v)
|
||||
v.Op = OpLOONG64LoweredPanicBoundsRR
|
||||
return true
|
||||
case OpPopCount16:
|
||||
return rewriteValueLOONG64_OpPopCount16(v)
|
||||
case OpPopCount32:
|
||||
|
|
@ -2070,6 +2077,86 @@ func rewriteValueLOONG64_OpLOONG64DIVVU(v *Value) bool {
|
|||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueLOONG64_OpLOONG64LoweredPanicBoundsCR(v *Value) bool {
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (LoweredPanicBoundsCR [kind] {p} (MOVVconst [c]) mem)
|
||||
// result: (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:p.C, Cy:c}} mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
p := auxToPanicBoundsC(v.Aux)
|
||||
if v_0.Op != OpLOONG64MOVVconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt64(v_0.AuxInt)
|
||||
mem := v_1
|
||||
v.reset(OpLOONG64LoweredPanicBoundsCC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCCToAux(PanicBoundsCC{Cx: p.C, Cy: c})
|
||||
v.AddArg(mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueLOONG64_OpLOONG64LoweredPanicBoundsRC(v *Value) bool {
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (LoweredPanicBoundsRC [kind] {p} (MOVVconst [c]) mem)
|
||||
// result: (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:c, Cy:p.C}} mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
p := auxToPanicBoundsC(v.Aux)
|
||||
if v_0.Op != OpLOONG64MOVVconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt64(v_0.AuxInt)
|
||||
mem := v_1
|
||||
v.reset(OpLOONG64LoweredPanicBoundsCC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCCToAux(PanicBoundsCC{Cx: c, Cy: p.C})
|
||||
v.AddArg(mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueLOONG64_OpLOONG64LoweredPanicBoundsRR(v *Value) bool {
|
||||
v_2 := v.Args[2]
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (LoweredPanicBoundsRR [kind] x (MOVVconst [c]) mem)
|
||||
// result: (LoweredPanicBoundsRC [kind] x {PanicBoundsC{C:c}} mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
x := v_0
|
||||
if v_1.Op != OpLOONG64MOVVconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt64(v_1.AuxInt)
|
||||
mem := v_2
|
||||
v.reset(OpLOONG64LoweredPanicBoundsRC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCToAux(PanicBoundsC{C: c})
|
||||
v.AddArg2(x, mem)
|
||||
return true
|
||||
}
|
||||
// match: (LoweredPanicBoundsRR [kind] (MOVVconst [c]) y mem)
|
||||
// result: (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:c}} y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
if v_0.Op != OpLOONG64MOVVconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt64(v_0.AuxInt)
|
||||
y := v_1
|
||||
mem := v_2
|
||||
v.reset(OpLOONG64LoweredPanicBoundsCR)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCToAux(PanicBoundsC{C: c})
|
||||
v.AddArg2(y, mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueLOONG64_OpLOONG64MASKEQZ(v *Value) bool {
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
|
|
@ -2378,6 +2465,21 @@ func rewriteValueLOONG64_OpLOONG64MOVBUreg(v *Value) bool {
|
|||
v.AddArg(x)
|
||||
return true
|
||||
}
|
||||
// match: (MOVBUreg x:(ANDconst [c] y))
|
||||
// cond: c >= 0 && int64(uint8(c)) == c
|
||||
// result: x
|
||||
for {
|
||||
x := v_0
|
||||
if x.Op != OpLOONG64ANDconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt64(x.AuxInt)
|
||||
if !(c >= 0 && int64(uint8(c)) == c) {
|
||||
break
|
||||
}
|
||||
v.copyOf(x)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueLOONG64_OpLOONG64MOVBload(v *Value) bool {
|
||||
|
|
@ -2526,6 +2628,21 @@ func rewriteValueLOONG64_OpLOONG64MOVBreg(v *Value) bool {
|
|||
v.AuxInt = int64ToAuxInt(int64(int8(c)))
|
||||
return true
|
||||
}
|
||||
// match: (MOVBreg x:(ANDconst [c] y))
|
||||
// cond: c >= 0 && int64(int8(c)) == c
|
||||
// result: x
|
||||
for {
|
||||
x := v_0
|
||||
if x.Op != OpLOONG64ANDconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt64(x.AuxInt)
|
||||
if !(c >= 0 && int64(int8(c)) == c) {
|
||||
break
|
||||
}
|
||||
v.copyOf(x)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueLOONG64_OpLOONG64MOVBstore(v *Value) bool {
|
||||
|
|
@ -3614,6 +3731,21 @@ func rewriteValueLOONG64_OpLOONG64MOVHUreg(v *Value) bool {
|
|||
v.AuxInt = int64ToAuxInt(int64(uint16(c)))
|
||||
return true
|
||||
}
|
||||
// match: (MOVHUreg x:(ANDconst [c] y))
|
||||
// cond: c >= 0 && int64(uint16(c)) == c
|
||||
// result: x
|
||||
for {
|
||||
x := v_0
|
||||
if x.Op != OpLOONG64ANDconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt64(x.AuxInt)
|
||||
if !(c >= 0 && int64(uint16(c)) == c) {
|
||||
break
|
||||
}
|
||||
v.copyOf(x)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueLOONG64_OpLOONG64MOVHload(v *Value) bool {
|
||||
|
|
@ -3806,6 +3938,21 @@ func rewriteValueLOONG64_OpLOONG64MOVHreg(v *Value) bool {
|
|||
v.AuxInt = int64ToAuxInt(int64(int16(c)))
|
||||
return true
|
||||
}
|
||||
// match: (MOVHreg x:(ANDconst [c] y))
|
||||
// cond: c >= 0 && int64(int16(c)) == c
|
||||
// result: x
|
||||
for {
|
||||
x := v_0
|
||||
if x.Op != OpLOONG64ANDconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt64(x.AuxInt)
|
||||
if !(c >= 0 && int64(int16(c)) == c) {
|
||||
break
|
||||
}
|
||||
v.copyOf(x)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueLOONG64_OpLOONG64MOVHstore(v *Value) bool {
|
||||
|
|
@ -4821,6 +4968,21 @@ func rewriteValueLOONG64_OpLOONG64MOVWUreg(v *Value) bool {
|
|||
v.AuxInt = int64ToAuxInt(int64(uint32(c)))
|
||||
return true
|
||||
}
|
||||
// match: (MOVWUreg x:(ANDconst [c] y))
|
||||
// cond: c >= 0 && int64(uint32(c)) == c
|
||||
// result: x
|
||||
for {
|
||||
x := v_0
|
||||
if x.Op != OpLOONG64ANDconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt64(x.AuxInt)
|
||||
if !(c >= 0 && int64(uint32(c)) == c) {
|
||||
break
|
||||
}
|
||||
v.copyOf(x)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueLOONG64_OpLOONG64MOVWload(v *Value) bool {
|
||||
|
|
@ -5046,6 +5208,21 @@ func rewriteValueLOONG64_OpLOONG64MOVWreg(v *Value) bool {
|
|||
v.AuxInt = int64ToAuxInt(int64(int32(c)))
|
||||
return true
|
||||
}
|
||||
// match: (MOVWreg x:(ANDconst [c] y))
|
||||
// cond: c >= 0 && int64(int32(c)) == c
|
||||
// result: x
|
||||
for {
|
||||
x := v_0
|
||||
if x.Op != OpLOONG64ANDconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt64(x.AuxInt)
|
||||
if !(c >= 0 && int64(int32(c)) == c) {
|
||||
break
|
||||
}
|
||||
v.copyOf(x)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueLOONG64_OpLOONG64MOVWstore(v *Value) bool {
|
||||
|
|
@ -5360,20 +5537,8 @@ func rewriteValueLOONG64_OpLOONG64MOVWstorezeroidx(v *Value) bool {
|
|||
func rewriteValueLOONG64_OpLOONG64MULV(v *Value) bool {
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (MULV x (MOVVconst [-1]))
|
||||
// result: (NEGV x)
|
||||
for {
|
||||
for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
|
||||
x := v_0
|
||||
if v_1.Op != OpLOONG64MOVVconst || auxIntToInt64(v_1.AuxInt) != -1 {
|
||||
continue
|
||||
}
|
||||
v.reset(OpLOONG64NEGV)
|
||||
v.AddArg(x)
|
||||
return true
|
||||
}
|
||||
break
|
||||
}
|
||||
b := v.Block
|
||||
config := b.Func.Config
|
||||
// match: (MULV _ (MOVVconst [0]))
|
||||
// result: (MOVVconst [0])
|
||||
for {
|
||||
|
|
@ -5401,8 +5566,8 @@ func rewriteValueLOONG64_OpLOONG64MULV(v *Value) bool {
|
|||
break
|
||||
}
|
||||
// match: (MULV x (MOVVconst [c]))
|
||||
// cond: isPowerOfTwo(c)
|
||||
// result: (SLLVconst [log64(c)] x)
|
||||
// cond: canMulStrengthReduce(config, c)
|
||||
// result: {mulStrengthReduce(v, x, c)}
|
||||
for {
|
||||
for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
|
||||
x := v_0
|
||||
|
|
@ -5410,12 +5575,10 @@ func rewriteValueLOONG64_OpLOONG64MULV(v *Value) bool {
|
|||
continue
|
||||
}
|
||||
c := auxIntToInt64(v_1.AuxInt)
|
||||
if !(isPowerOfTwo(c)) {
|
||||
if !(canMulStrengthReduce(config, c)) {
|
||||
continue
|
||||
}
|
||||
v.reset(OpLOONG64SLLVconst)
|
||||
v.AuxInt = int64ToAuxInt(log64(c))
|
||||
v.AddArg(x)
|
||||
v.copyOf(mulStrengthReduce(v, x, c))
|
||||
return true
|
||||
}
|
||||
break
|
||||
|
|
@ -9016,60 +9179,6 @@ func rewriteValueLOONG64_OpOffPtr(v *Value) bool {
|
|||
return true
|
||||
}
|
||||
}
|
||||
func rewriteValueLOONG64_OpPanicBounds(v *Value) bool {
|
||||
v_2 := v.Args[2]
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (PanicBounds [kind] x y mem)
|
||||
// cond: boundsABI(kind) == 0
|
||||
// result: (LoweredPanicBoundsA [kind] x y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
x := v_0
|
||||
y := v_1
|
||||
mem := v_2
|
||||
if !(boundsABI(kind) == 0) {
|
||||
break
|
||||
}
|
||||
v.reset(OpLOONG64LoweredPanicBoundsA)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.AddArg3(x, y, mem)
|
||||
return true
|
||||
}
|
||||
// match: (PanicBounds [kind] x y mem)
|
||||
// cond: boundsABI(kind) == 1
|
||||
// result: (LoweredPanicBoundsB [kind] x y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
x := v_0
|
||||
y := v_1
|
||||
mem := v_2
|
||||
if !(boundsABI(kind) == 1) {
|
||||
break
|
||||
}
|
||||
v.reset(OpLOONG64LoweredPanicBoundsB)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.AddArg3(x, y, mem)
|
||||
return true
|
||||
}
|
||||
// match: (PanicBounds [kind] x y mem)
|
||||
// cond: boundsABI(kind) == 2
|
||||
// result: (LoweredPanicBoundsC [kind] x y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
x := v_0
|
||||
y := v_1
|
||||
mem := v_2
|
||||
if !(boundsABI(kind) == 2) {
|
||||
break
|
||||
}
|
||||
v.reset(OpLOONG64LoweredPanicBoundsC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.AddArg3(x, y, mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueLOONG64_OpPopCount16(v *Value) bool {
|
||||
v_0 := v.Args[0]
|
||||
b := v.Block
|
||||
|
|
|
|||
29
src/cmd/compile/internal/ssa/rewriteLOONG64latelower.go
Normal file
29
src/cmd/compile/internal/ssa/rewriteLOONG64latelower.go
Normal file
|
|
@ -0,0 +1,29 @@
|
|||
// Code generated from _gen/LOONG64latelower.rules using 'go generate'; DO NOT EDIT.
|
||||
|
||||
package ssa
|
||||
|
||||
func rewriteValueLOONG64latelower(v *Value) bool {
|
||||
switch v.Op {
|
||||
case OpLOONG64SLLVconst:
|
||||
return rewriteValueLOONG64latelower_OpLOONG64SLLVconst(v)
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueLOONG64latelower_OpLOONG64SLLVconst(v *Value) bool {
|
||||
v_0 := v.Args[0]
|
||||
// match: (SLLVconst [1] x)
|
||||
// result: (ADDV x x)
|
||||
for {
|
||||
if auxIntToInt64(v.AuxInt) != 1 {
|
||||
break
|
||||
}
|
||||
x := v_0
|
||||
v.reset(OpLOONG64ADDV)
|
||||
v.AddArg2(x, x)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteBlockLOONG64latelower(b *Block) bool {
|
||||
return false
|
||||
}
|
||||
|
|
@ -279,6 +279,14 @@ func rewriteValueMIPS(v *Value) bool {
|
|||
return rewriteValueMIPS_OpMIPSLoweredAtomicAdd(v)
|
||||
case OpMIPSLoweredAtomicStore32:
|
||||
return rewriteValueMIPS_OpMIPSLoweredAtomicStore32(v)
|
||||
case OpMIPSLoweredPanicBoundsRC:
|
||||
return rewriteValueMIPS_OpMIPSLoweredPanicBoundsRC(v)
|
||||
case OpMIPSLoweredPanicBoundsRR:
|
||||
return rewriteValueMIPS_OpMIPSLoweredPanicBoundsRR(v)
|
||||
case OpMIPSLoweredPanicExtendRC:
|
||||
return rewriteValueMIPS_OpMIPSLoweredPanicExtendRC(v)
|
||||
case OpMIPSLoweredPanicExtendRR:
|
||||
return rewriteValueMIPS_OpMIPSLoweredPanicExtendRR(v)
|
||||
case OpMIPSMOVBUload:
|
||||
return rewriteValueMIPS_OpMIPSMOVBUload(v)
|
||||
case OpMIPSMOVBUreg:
|
||||
|
|
@ -447,9 +455,11 @@ func rewriteValueMIPS(v *Value) bool {
|
|||
v.Op = OpMIPSOR
|
||||
return true
|
||||
case OpPanicBounds:
|
||||
return rewriteValueMIPS_OpPanicBounds(v)
|
||||
v.Op = OpMIPSLoweredPanicBoundsRR
|
||||
return true
|
||||
case OpPanicExtend:
|
||||
return rewriteValueMIPS_OpPanicExtend(v)
|
||||
v.Op = OpMIPSLoweredPanicExtendRR
|
||||
return true
|
||||
case OpPubBarrier:
|
||||
v.Op = OpMIPSLoweredPubBarrier
|
||||
return true
|
||||
|
|
@ -2435,6 +2445,135 @@ func rewriteValueMIPS_OpMIPSLoweredAtomicStore32(v *Value) bool {
|
|||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueMIPS_OpMIPSLoweredPanicBoundsRC(v *Value) bool {
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (LoweredPanicBoundsRC [kind] {p} (MOVWconst [c]) mem)
|
||||
// result: (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:int64(c), Cy:p.C}} mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
p := auxToPanicBoundsC(v.Aux)
|
||||
if v_0.Op != OpMIPSMOVWconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt32(v_0.AuxInt)
|
||||
mem := v_1
|
||||
v.reset(OpMIPSLoweredPanicBoundsCC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCCToAux(PanicBoundsCC{Cx: int64(c), Cy: p.C})
|
||||
v.AddArg(mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueMIPS_OpMIPSLoweredPanicBoundsRR(v *Value) bool {
|
||||
v_2 := v.Args[2]
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (LoweredPanicBoundsRR [kind] x (MOVWconst [c]) mem)
|
||||
// result: (LoweredPanicBoundsRC [kind] x {PanicBoundsC{C:int64(c)}} mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
x := v_0
|
||||
if v_1.Op != OpMIPSMOVWconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt32(v_1.AuxInt)
|
||||
mem := v_2
|
||||
v.reset(OpMIPSLoweredPanicBoundsRC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCToAux(PanicBoundsC{C: int64(c)})
|
||||
v.AddArg2(x, mem)
|
||||
return true
|
||||
}
|
||||
// match: (LoweredPanicBoundsRR [kind] (MOVWconst [c]) y mem)
|
||||
// result: (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:int64(c)}} y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
if v_0.Op != OpMIPSMOVWconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt32(v_0.AuxInt)
|
||||
y := v_1
|
||||
mem := v_2
|
||||
v.reset(OpMIPSLoweredPanicBoundsCR)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCToAux(PanicBoundsC{C: int64(c)})
|
||||
v.AddArg2(y, mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueMIPS_OpMIPSLoweredPanicExtendRC(v *Value) bool {
|
||||
v_2 := v.Args[2]
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (LoweredPanicExtendRC [kind] {p} (MOVWconst [hi]) (MOVWconst [lo]) mem)
|
||||
// result: (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:int64(hi)<<32+int64(uint32(lo)), Cy:p.C}} mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
p := auxToPanicBoundsC(v.Aux)
|
||||
if v_0.Op != OpMIPSMOVWconst {
|
||||
break
|
||||
}
|
||||
hi := auxIntToInt32(v_0.AuxInt)
|
||||
if v_1.Op != OpMIPSMOVWconst {
|
||||
break
|
||||
}
|
||||
lo := auxIntToInt32(v_1.AuxInt)
|
||||
mem := v_2
|
||||
v.reset(OpMIPSLoweredPanicBoundsCC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCCToAux(PanicBoundsCC{Cx: int64(hi)<<32 + int64(uint32(lo)), Cy: p.C})
|
||||
v.AddArg(mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueMIPS_OpMIPSLoweredPanicExtendRR(v *Value) bool {
|
||||
v_3 := v.Args[3]
|
||||
v_2 := v.Args[2]
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (LoweredPanicExtendRR [kind] hi lo (MOVWconst [c]) mem)
|
||||
// result: (LoweredPanicExtendRC [kind] hi lo {PanicBoundsC{C:int64(c)}} mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
hi := v_0
|
||||
lo := v_1
|
||||
if v_2.Op != OpMIPSMOVWconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt32(v_2.AuxInt)
|
||||
mem := v_3
|
||||
v.reset(OpMIPSLoweredPanicExtendRC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCToAux(PanicBoundsC{C: int64(c)})
|
||||
v.AddArg3(hi, lo, mem)
|
||||
return true
|
||||
}
|
||||
// match: (LoweredPanicExtendRR [kind] (MOVWconst [hi]) (MOVWconst [lo]) y mem)
|
||||
// result: (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:int64(hi)<<32 + int64(uint32(lo))}} y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
if v_0.Op != OpMIPSMOVWconst {
|
||||
break
|
||||
}
|
||||
hi := auxIntToInt32(v_0.AuxInt)
|
||||
if v_1.Op != OpMIPSMOVWconst {
|
||||
break
|
||||
}
|
||||
lo := auxIntToInt32(v_1.AuxInt)
|
||||
y := v_2
|
||||
mem := v_3
|
||||
v.reset(OpMIPSLoweredPanicBoundsCR)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCToAux(PanicBoundsC{C: int64(hi)<<32 + int64(uint32(lo))})
|
||||
v.AddArg2(y, mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueMIPS_OpMIPSMOVBUload(v *Value) bool {
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
|
|
@ -4058,8 +4197,8 @@ func rewriteValueMIPS_OpMIPSMUL(v *Value) bool {
|
|||
break
|
||||
}
|
||||
// match: (MUL (MOVWconst [c]) x )
|
||||
// cond: isPowerOfTwo(int64(uint32(c)))
|
||||
// result: (SLLconst [int32(log2uint32(int64(c)))] x)
|
||||
// cond: isUnsignedPowerOfTwo(uint32(c))
|
||||
// result: (SLLconst [int32(log32u(uint32(c)))] x)
|
||||
for {
|
||||
for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
|
||||
if v_0.Op != OpMIPSMOVWconst {
|
||||
|
|
@ -4067,11 +4206,11 @@ func rewriteValueMIPS_OpMIPSMUL(v *Value) bool {
|
|||
}
|
||||
c := auxIntToInt32(v_0.AuxInt)
|
||||
x := v_1
|
||||
if !(isPowerOfTwo(int64(uint32(c)))) {
|
||||
if !(isUnsignedPowerOfTwo(uint32(c))) {
|
||||
continue
|
||||
}
|
||||
v.reset(OpMIPSSLLconst)
|
||||
v.AuxInt = int32ToAuxInt(int32(log2uint32(int64(c))))
|
||||
v.AuxInt = int32ToAuxInt(int32(log32u(uint32(c))))
|
||||
v.AddArg(x)
|
||||
return true
|
||||
}
|
||||
|
|
@ -5586,118 +5725,6 @@ func rewriteValueMIPS_OpOffPtr(v *Value) bool {
|
|||
return true
|
||||
}
|
||||
}
|
||||
func rewriteValueMIPS_OpPanicBounds(v *Value) bool {
|
||||
v_2 := v.Args[2]
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (PanicBounds [kind] x y mem)
|
||||
// cond: boundsABI(kind) == 0
|
||||
// result: (LoweredPanicBoundsA [kind] x y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
x := v_0
|
||||
y := v_1
|
||||
mem := v_2
|
||||
if !(boundsABI(kind) == 0) {
|
||||
break
|
||||
}
|
||||
v.reset(OpMIPSLoweredPanicBoundsA)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.AddArg3(x, y, mem)
|
||||
return true
|
||||
}
|
||||
// match: (PanicBounds [kind] x y mem)
|
||||
// cond: boundsABI(kind) == 1
|
||||
// result: (LoweredPanicBoundsB [kind] x y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
x := v_0
|
||||
y := v_1
|
||||
mem := v_2
|
||||
if !(boundsABI(kind) == 1) {
|
||||
break
|
||||
}
|
||||
v.reset(OpMIPSLoweredPanicBoundsB)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.AddArg3(x, y, mem)
|
||||
return true
|
||||
}
|
||||
// match: (PanicBounds [kind] x y mem)
|
||||
// cond: boundsABI(kind) == 2
|
||||
// result: (LoweredPanicBoundsC [kind] x y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
x := v_0
|
||||
y := v_1
|
||||
mem := v_2
|
||||
if !(boundsABI(kind) == 2) {
|
||||
break
|
||||
}
|
||||
v.reset(OpMIPSLoweredPanicBoundsC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.AddArg3(x, y, mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueMIPS_OpPanicExtend(v *Value) bool {
|
||||
v_3 := v.Args[3]
|
||||
v_2 := v.Args[2]
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (PanicExtend [kind] hi lo y mem)
|
||||
// cond: boundsABI(kind) == 0
|
||||
// result: (LoweredPanicExtendA [kind] hi lo y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
hi := v_0
|
||||
lo := v_1
|
||||
y := v_2
|
||||
mem := v_3
|
||||
if !(boundsABI(kind) == 0) {
|
||||
break
|
||||
}
|
||||
v.reset(OpMIPSLoweredPanicExtendA)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.AddArg4(hi, lo, y, mem)
|
||||
return true
|
||||
}
|
||||
// match: (PanicExtend [kind] hi lo y mem)
|
||||
// cond: boundsABI(kind) == 1
|
||||
// result: (LoweredPanicExtendB [kind] hi lo y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
hi := v_0
|
||||
lo := v_1
|
||||
y := v_2
|
||||
mem := v_3
|
||||
if !(boundsABI(kind) == 1) {
|
||||
break
|
||||
}
|
||||
v.reset(OpMIPSLoweredPanicExtendB)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.AddArg4(hi, lo, y, mem)
|
||||
return true
|
||||
}
|
||||
// match: (PanicExtend [kind] hi lo y mem)
|
||||
// cond: boundsABI(kind) == 2
|
||||
// result: (LoweredPanicExtendC [kind] hi lo y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
hi := v_0
|
||||
lo := v_1
|
||||
y := v_2
|
||||
mem := v_3
|
||||
if !(boundsABI(kind) == 2) {
|
||||
break
|
||||
}
|
||||
v.reset(OpMIPSLoweredPanicExtendC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.AddArg4(hi, lo, y, mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueMIPS_OpRotateLeft16(v *Value) bool {
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
|
|
@ -6611,8 +6638,8 @@ func rewriteValueMIPS_OpSelect0(v *Value) bool {
|
|||
break
|
||||
}
|
||||
// match: (Select0 (MULTU (MOVWconst [c]) x ))
|
||||
// cond: isPowerOfTwo(int64(uint32(c)))
|
||||
// result: (SRLconst [int32(32-log2uint32(int64(c)))] x)
|
||||
// cond: isUnsignedPowerOfTwo(uint32(c))
|
||||
// result: (SRLconst [int32(32-log32u(uint32(c)))] x)
|
||||
for {
|
||||
if v_0.Op != OpMIPSMULTU {
|
||||
break
|
||||
|
|
@ -6626,11 +6653,11 @@ func rewriteValueMIPS_OpSelect0(v *Value) bool {
|
|||
}
|
||||
c := auxIntToInt32(v_0_0.AuxInt)
|
||||
x := v_0_1
|
||||
if !(isPowerOfTwo(int64(uint32(c)))) {
|
||||
if !(isUnsignedPowerOfTwo(uint32(c))) {
|
||||
continue
|
||||
}
|
||||
v.reset(OpMIPSSRLconst)
|
||||
v.AuxInt = int32ToAuxInt(int32(32 - log2uint32(int64(c))))
|
||||
v.AuxInt = int32ToAuxInt(int32(32 - log32u(uint32(c))))
|
||||
v.AddArg(x)
|
||||
return true
|
||||
}
|
||||
|
|
@ -6807,8 +6834,8 @@ func rewriteValueMIPS_OpSelect1(v *Value) bool {
|
|||
break
|
||||
}
|
||||
// match: (Select1 (MULTU (MOVWconst [c]) x ))
|
||||
// cond: isPowerOfTwo(int64(uint32(c)))
|
||||
// result: (SLLconst [int32(log2uint32(int64(c)))] x)
|
||||
// cond: isUnsignedPowerOfTwo(uint32(c))
|
||||
// result: (SLLconst [int32(log32u(uint32(c)))] x)
|
||||
for {
|
||||
if v_0.Op != OpMIPSMULTU {
|
||||
break
|
||||
|
|
@ -6822,11 +6849,11 @@ func rewriteValueMIPS_OpSelect1(v *Value) bool {
|
|||
}
|
||||
c := auxIntToInt32(v_0_0.AuxInt)
|
||||
x := v_0_1
|
||||
if !(isPowerOfTwo(int64(uint32(c)))) {
|
||||
if !(isUnsignedPowerOfTwo(uint32(c))) {
|
||||
continue
|
||||
}
|
||||
v.reset(OpMIPSSLLconst)
|
||||
v.AuxInt = int32ToAuxInt(int32(log2uint32(int64(c))))
|
||||
v.AuxInt = int32ToAuxInt(int32(log32u(uint32(c))))
|
||||
v.AddArg(x)
|
||||
return true
|
||||
}
|
||||
|
|
|
|||
|
|
@ -316,6 +316,12 @@ func rewriteValueMIPS64(v *Value) bool {
|
|||
return rewriteValueMIPS64_OpMIPS64LoweredAtomicStore32(v)
|
||||
case OpMIPS64LoweredAtomicStore64:
|
||||
return rewriteValueMIPS64_OpMIPS64LoweredAtomicStore64(v)
|
||||
case OpMIPS64LoweredPanicBoundsCR:
|
||||
return rewriteValueMIPS64_OpMIPS64LoweredPanicBoundsCR(v)
|
||||
case OpMIPS64LoweredPanicBoundsRC:
|
||||
return rewriteValueMIPS64_OpMIPS64LoweredPanicBoundsRC(v)
|
||||
case OpMIPS64LoweredPanicBoundsRR:
|
||||
return rewriteValueMIPS64_OpMIPS64LoweredPanicBoundsRR(v)
|
||||
case OpMIPS64MOVBUload:
|
||||
return rewriteValueMIPS64_OpMIPS64MOVBUload(v)
|
||||
case OpMIPS64MOVBUreg:
|
||||
|
|
@ -501,7 +507,8 @@ func rewriteValueMIPS64(v *Value) bool {
|
|||
v.Op = OpMIPS64OR
|
||||
return true
|
||||
case OpPanicBounds:
|
||||
return rewriteValueMIPS64_OpPanicBounds(v)
|
||||
v.Op = OpMIPS64LoweredPanicBoundsRR
|
||||
return true
|
||||
case OpPubBarrier:
|
||||
v.Op = OpMIPS64LoweredPubBarrier
|
||||
return true
|
||||
|
|
@ -2757,6 +2764,86 @@ func rewriteValueMIPS64_OpMIPS64LoweredAtomicStore64(v *Value) bool {
|
|||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueMIPS64_OpMIPS64LoweredPanicBoundsCR(v *Value) bool {
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (LoweredPanicBoundsCR [kind] {p} (MOVVconst [c]) mem)
|
||||
// result: (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:p.C, Cy:c}} mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
p := auxToPanicBoundsC(v.Aux)
|
||||
if v_0.Op != OpMIPS64MOVVconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt64(v_0.AuxInt)
|
||||
mem := v_1
|
||||
v.reset(OpMIPS64LoweredPanicBoundsCC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCCToAux(PanicBoundsCC{Cx: p.C, Cy: c})
|
||||
v.AddArg(mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueMIPS64_OpMIPS64LoweredPanicBoundsRC(v *Value) bool {
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (LoweredPanicBoundsRC [kind] {p} (MOVVconst [c]) mem)
|
||||
// result: (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:c, Cy:p.C}} mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
p := auxToPanicBoundsC(v.Aux)
|
||||
if v_0.Op != OpMIPS64MOVVconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt64(v_0.AuxInt)
|
||||
mem := v_1
|
||||
v.reset(OpMIPS64LoweredPanicBoundsCC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCCToAux(PanicBoundsCC{Cx: c, Cy: p.C})
|
||||
v.AddArg(mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueMIPS64_OpMIPS64LoweredPanicBoundsRR(v *Value) bool {
|
||||
v_2 := v.Args[2]
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (LoweredPanicBoundsRR [kind] x (MOVVconst [c]) mem)
|
||||
// result: (LoweredPanicBoundsRC [kind] x {PanicBoundsC{C:c}} mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
x := v_0
|
||||
if v_1.Op != OpMIPS64MOVVconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt64(v_1.AuxInt)
|
||||
mem := v_2
|
||||
v.reset(OpMIPS64LoweredPanicBoundsRC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCToAux(PanicBoundsC{C: c})
|
||||
v.AddArg2(x, mem)
|
||||
return true
|
||||
}
|
||||
// match: (LoweredPanicBoundsRR [kind] (MOVVconst [c]) y mem)
|
||||
// result: (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:c}} y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
if v_0.Op != OpMIPS64MOVVconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt64(v_0.AuxInt)
|
||||
y := v_1
|
||||
mem := v_2
|
||||
v.reset(OpMIPS64LoweredPanicBoundsCR)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCToAux(PanicBoundsC{C: c})
|
||||
v.AddArg2(y, mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueMIPS64_OpMIPS64MOVBUload(v *Value) bool {
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
|
|
@ -6364,60 +6451,6 @@ func rewriteValueMIPS64_OpOffPtr(v *Value) bool {
|
|||
return true
|
||||
}
|
||||
}
|
||||
func rewriteValueMIPS64_OpPanicBounds(v *Value) bool {
|
||||
v_2 := v.Args[2]
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (PanicBounds [kind] x y mem)
|
||||
// cond: boundsABI(kind) == 0
|
||||
// result: (LoweredPanicBoundsA [kind] x y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
x := v_0
|
||||
y := v_1
|
||||
mem := v_2
|
||||
if !(boundsABI(kind) == 0) {
|
||||
break
|
||||
}
|
||||
v.reset(OpMIPS64LoweredPanicBoundsA)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.AddArg3(x, y, mem)
|
||||
return true
|
||||
}
|
||||
// match: (PanicBounds [kind] x y mem)
|
||||
// cond: boundsABI(kind) == 1
|
||||
// result: (LoweredPanicBoundsB [kind] x y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
x := v_0
|
||||
y := v_1
|
||||
mem := v_2
|
||||
if !(boundsABI(kind) == 1) {
|
||||
break
|
||||
}
|
||||
v.reset(OpMIPS64LoweredPanicBoundsB)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.AddArg3(x, y, mem)
|
||||
return true
|
||||
}
|
||||
// match: (PanicBounds [kind] x y mem)
|
||||
// cond: boundsABI(kind) == 2
|
||||
// result: (LoweredPanicBoundsC [kind] x y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
x := v_0
|
||||
y := v_1
|
||||
mem := v_2
|
||||
if !(boundsABI(kind) == 2) {
|
||||
break
|
||||
}
|
||||
v.reset(OpMIPS64LoweredPanicBoundsC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.AddArg3(x, y, mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueMIPS64_OpRotateLeft16(v *Value) bool {
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
|
|
|
|||
|
|
@ -486,7 +486,8 @@ func rewriteValueRISCV64(v *Value) bool {
|
|||
v.Op = OpRISCV64OR
|
||||
return true
|
||||
case OpPanicBounds:
|
||||
return rewriteValueRISCV64_OpPanicBounds(v)
|
||||
v.Op = OpRISCV64LoweredPanicBoundsRR
|
||||
return true
|
||||
case OpPopCount16:
|
||||
return rewriteValueRISCV64_OpPopCount16(v)
|
||||
case OpPopCount32:
|
||||
|
|
@ -532,6 +533,12 @@ func rewriteValueRISCV64(v *Value) bool {
|
|||
return rewriteValueRISCV64_OpRISCV64FSUBD(v)
|
||||
case OpRISCV64FSUBS:
|
||||
return rewriteValueRISCV64_OpRISCV64FSUBS(v)
|
||||
case OpRISCV64LoweredPanicBoundsCR:
|
||||
return rewriteValueRISCV64_OpRISCV64LoweredPanicBoundsCR(v)
|
||||
case OpRISCV64LoweredPanicBoundsRC:
|
||||
return rewriteValueRISCV64_OpRISCV64LoweredPanicBoundsRC(v)
|
||||
case OpRISCV64LoweredPanicBoundsRR:
|
||||
return rewriteValueRISCV64_OpRISCV64LoweredPanicBoundsRR(v)
|
||||
case OpRISCV64MOVBUload:
|
||||
return rewriteValueRISCV64_OpRISCV64MOVBUload(v)
|
||||
case OpRISCV64MOVBUreg:
|
||||
|
|
@ -3416,60 +3423,6 @@ func rewriteValueRISCV64_OpOffPtr(v *Value) bool {
|
|||
return true
|
||||
}
|
||||
}
|
||||
func rewriteValueRISCV64_OpPanicBounds(v *Value) bool {
|
||||
v_2 := v.Args[2]
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (PanicBounds [kind] x y mem)
|
||||
// cond: boundsABI(kind) == 0
|
||||
// result: (LoweredPanicBoundsA [kind] x y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
x := v_0
|
||||
y := v_1
|
||||
mem := v_2
|
||||
if !(boundsABI(kind) == 0) {
|
||||
break
|
||||
}
|
||||
v.reset(OpRISCV64LoweredPanicBoundsA)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.AddArg3(x, y, mem)
|
||||
return true
|
||||
}
|
||||
// match: (PanicBounds [kind] x y mem)
|
||||
// cond: boundsABI(kind) == 1
|
||||
// result: (LoweredPanicBoundsB [kind] x y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
x := v_0
|
||||
y := v_1
|
||||
mem := v_2
|
||||
if !(boundsABI(kind) == 1) {
|
||||
break
|
||||
}
|
||||
v.reset(OpRISCV64LoweredPanicBoundsB)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.AddArg3(x, y, mem)
|
||||
return true
|
||||
}
|
||||
// match: (PanicBounds [kind] x y mem)
|
||||
// cond: boundsABI(kind) == 2
|
||||
// result: (LoweredPanicBoundsC [kind] x y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
x := v_0
|
||||
y := v_1
|
||||
mem := v_2
|
||||
if !(boundsABI(kind) == 2) {
|
||||
break
|
||||
}
|
||||
v.reset(OpRISCV64LoweredPanicBoundsC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.AddArg3(x, y, mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueRISCV64_OpPopCount16(v *Value) bool {
|
||||
v_0 := v.Args[0]
|
||||
b := v.Block
|
||||
|
|
@ -4239,6 +4192,86 @@ func rewriteValueRISCV64_OpRISCV64FSUBS(v *Value) bool {
|
|||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueRISCV64_OpRISCV64LoweredPanicBoundsCR(v *Value) bool {
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (LoweredPanicBoundsCR [kind] {p} (MOVDconst [c]) mem)
|
||||
// result: (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:p.C, Cy:c}} mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
p := auxToPanicBoundsC(v.Aux)
|
||||
if v_0.Op != OpRISCV64MOVDconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt64(v_0.AuxInt)
|
||||
mem := v_1
|
||||
v.reset(OpRISCV64LoweredPanicBoundsCC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCCToAux(PanicBoundsCC{Cx: p.C, Cy: c})
|
||||
v.AddArg(mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueRISCV64_OpRISCV64LoweredPanicBoundsRC(v *Value) bool {
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (LoweredPanicBoundsRC [kind] {p} (MOVDconst [c]) mem)
|
||||
// result: (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:c, Cy:p.C}} mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
p := auxToPanicBoundsC(v.Aux)
|
||||
if v_0.Op != OpRISCV64MOVDconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt64(v_0.AuxInt)
|
||||
mem := v_1
|
||||
v.reset(OpRISCV64LoweredPanicBoundsCC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCCToAux(PanicBoundsCC{Cx: c, Cy: p.C})
|
||||
v.AddArg(mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueRISCV64_OpRISCV64LoweredPanicBoundsRR(v *Value) bool {
|
||||
v_2 := v.Args[2]
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (LoweredPanicBoundsRR [kind] x (MOVDconst [c]) mem)
|
||||
// result: (LoweredPanicBoundsRC [kind] x {PanicBoundsC{C:c}} mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
x := v_0
|
||||
if v_1.Op != OpRISCV64MOVDconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt64(v_1.AuxInt)
|
||||
mem := v_2
|
||||
v.reset(OpRISCV64LoweredPanicBoundsRC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCToAux(PanicBoundsC{C: c})
|
||||
v.AddArg2(x, mem)
|
||||
return true
|
||||
}
|
||||
// match: (LoweredPanicBoundsRR [kind] (MOVDconst [c]) y mem)
|
||||
// result: (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:c}} y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
if v_0.Op != OpRISCV64MOVDconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt64(v_0.AuxInt)
|
||||
y := v_1
|
||||
mem := v_2
|
||||
v.reset(OpRISCV64LoweredPanicBoundsCR)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCToAux(PanicBoundsC{C: c})
|
||||
v.AddArg2(y, mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueRISCV64_OpRISCV64MOVBUload(v *Value) bool {
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
|
|
|
|||
|
|
@ -368,6 +368,18 @@ func rewriteValueS390X(v *Value) bool {
|
|||
return rewriteValueS390X_OpLsh8x64(v)
|
||||
case OpLsh8x8:
|
||||
return rewriteValueS390X_OpLsh8x8(v)
|
||||
case OpMax32F:
|
||||
v.Op = OpS390XWFMAXSB
|
||||
return true
|
||||
case OpMax64F:
|
||||
v.Op = OpS390XWFMAXDB
|
||||
return true
|
||||
case OpMin32F:
|
||||
v.Op = OpS390XWFMINSB
|
||||
return true
|
||||
case OpMin64F:
|
||||
v.Op = OpS390XWFMINDB
|
||||
return true
|
||||
case OpMod16:
|
||||
return rewriteValueS390X_OpMod16(v)
|
||||
case OpMod16u:
|
||||
|
|
@ -465,7 +477,8 @@ func rewriteValueS390X(v *Value) bool {
|
|||
v.Op = OpS390XORW
|
||||
return true
|
||||
case OpPanicBounds:
|
||||
return rewriteValueS390X_OpPanicBounds(v)
|
||||
v.Op = OpS390XLoweredPanicBoundsRR
|
||||
return true
|
||||
case OpPopCount16:
|
||||
return rewriteValueS390X_OpPopCount16(v)
|
||||
case OpPopCount32:
|
||||
|
|
@ -632,6 +645,12 @@ func rewriteValueS390X(v *Value) bool {
|
|||
return rewriteValueS390X_OpS390XLTDBR(v)
|
||||
case OpS390XLTEBR:
|
||||
return rewriteValueS390X_OpS390XLTEBR(v)
|
||||
case OpS390XLoweredPanicBoundsCR:
|
||||
return rewriteValueS390X_OpS390XLoweredPanicBoundsCR(v)
|
||||
case OpS390XLoweredPanicBoundsRC:
|
||||
return rewriteValueS390X_OpS390XLoweredPanicBoundsRC(v)
|
||||
case OpS390XLoweredPanicBoundsRR:
|
||||
return rewriteValueS390X_OpS390XLoweredPanicBoundsRR(v)
|
||||
case OpS390XLoweredRound32F:
|
||||
return rewriteValueS390X_OpS390XLoweredRound32F(v)
|
||||
case OpS390XLoweredRound64F:
|
||||
|
|
@ -3959,60 +3978,6 @@ func rewriteValueS390X_OpOffPtr(v *Value) bool {
|
|||
return true
|
||||
}
|
||||
}
|
||||
func rewriteValueS390X_OpPanicBounds(v *Value) bool {
|
||||
v_2 := v.Args[2]
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (PanicBounds [kind] x y mem)
|
||||
// cond: boundsABI(kind) == 0
|
||||
// result: (LoweredPanicBoundsA [kind] x y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
x := v_0
|
||||
y := v_1
|
||||
mem := v_2
|
||||
if !(boundsABI(kind) == 0) {
|
||||
break
|
||||
}
|
||||
v.reset(OpS390XLoweredPanicBoundsA)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.AddArg3(x, y, mem)
|
||||
return true
|
||||
}
|
||||
// match: (PanicBounds [kind] x y mem)
|
||||
// cond: boundsABI(kind) == 1
|
||||
// result: (LoweredPanicBoundsB [kind] x y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
x := v_0
|
||||
y := v_1
|
||||
mem := v_2
|
||||
if !(boundsABI(kind) == 1) {
|
||||
break
|
||||
}
|
||||
v.reset(OpS390XLoweredPanicBoundsB)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.AddArg3(x, y, mem)
|
||||
return true
|
||||
}
|
||||
// match: (PanicBounds [kind] x y mem)
|
||||
// cond: boundsABI(kind) == 2
|
||||
// result: (LoweredPanicBoundsC [kind] x y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
x := v_0
|
||||
y := v_1
|
||||
mem := v_2
|
||||
if !(boundsABI(kind) == 2) {
|
||||
break
|
||||
}
|
||||
v.reset(OpS390XLoweredPanicBoundsC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.AddArg3(x, y, mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueS390X_OpPopCount16(v *Value) bool {
|
||||
v_0 := v.Args[0]
|
||||
b := v.Block
|
||||
|
|
@ -8135,6 +8100,86 @@ func rewriteValueS390X_OpS390XLTEBR(v *Value) bool {
|
|||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueS390X_OpS390XLoweredPanicBoundsCR(v *Value) bool {
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (LoweredPanicBoundsCR [kind] {p} (MOVDconst [c]) mem)
|
||||
// result: (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:p.C, Cy:c}} mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
p := auxToPanicBoundsC(v.Aux)
|
||||
if v_0.Op != OpS390XMOVDconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt64(v_0.AuxInt)
|
||||
mem := v_1
|
||||
v.reset(OpS390XLoweredPanicBoundsCC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCCToAux(PanicBoundsCC{Cx: p.C, Cy: c})
|
||||
v.AddArg(mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueS390X_OpS390XLoweredPanicBoundsRC(v *Value) bool {
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (LoweredPanicBoundsRC [kind] {p} (MOVDconst [c]) mem)
|
||||
// result: (LoweredPanicBoundsCC [kind] {PanicBoundsCC{Cx:c, Cy:p.C}} mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
p := auxToPanicBoundsC(v.Aux)
|
||||
if v_0.Op != OpS390XMOVDconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt64(v_0.AuxInt)
|
||||
mem := v_1
|
||||
v.reset(OpS390XLoweredPanicBoundsCC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCCToAux(PanicBoundsCC{Cx: c, Cy: p.C})
|
||||
v.AddArg(mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueS390X_OpS390XLoweredPanicBoundsRR(v *Value) bool {
|
||||
v_2 := v.Args[2]
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (LoweredPanicBoundsRR [kind] x (MOVDconst [c]) mem)
|
||||
// result: (LoweredPanicBoundsRC [kind] x {PanicBoundsC{C:c}} mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
x := v_0
|
||||
if v_1.Op != OpS390XMOVDconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt64(v_1.AuxInt)
|
||||
mem := v_2
|
||||
v.reset(OpS390XLoweredPanicBoundsRC)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCToAux(PanicBoundsC{C: c})
|
||||
v.AddArg2(x, mem)
|
||||
return true
|
||||
}
|
||||
// match: (LoweredPanicBoundsRR [kind] (MOVDconst [c]) y mem)
|
||||
// result: (LoweredPanicBoundsCR [kind] {PanicBoundsC{C:c}} y mem)
|
||||
for {
|
||||
kind := auxIntToInt64(v.AuxInt)
|
||||
if v_0.Op != OpS390XMOVDconst {
|
||||
break
|
||||
}
|
||||
c := auxIntToInt64(v_0.AuxInt)
|
||||
y := v_1
|
||||
mem := v_2
|
||||
v.reset(OpS390XLoweredPanicBoundsCR)
|
||||
v.AuxInt = int64ToAuxInt(kind)
|
||||
v.Aux = panicBoundsCToAux(PanicBoundsC{C: c})
|
||||
v.AddArg2(y, mem)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueS390X_OpS390XLoweredRound32F(v *Value) bool {
|
||||
v_0 := v.Args[0]
|
||||
// match: (LoweredRound32F x:(FMOVSconst))
|
||||
|
|
|
|||
Some files were not shown because too many files have changed in this diff Show more
Loading…
Add table
Add a link
Reference in a new issue