mirror of
https://github.com/golang/go.git
synced 2026-04-18 18:00:41 +00:00
[dev.simd] all: merge master (ca37d24) into dev.simd
Conflicts: - src/cmd/compile/internal/typecheck/builtin.go Merge List: + 2025-11-20ca37d24e0bnet/http: drop unused "broken" field from persistConn + 2025-11-204b740af56acmd/internal/obj/x86: handle global reference in From3 in dynlink mode + 2025-11-20790384c6c2spec: adjust rule for type parameter on RHS of alias declaration + 2025-11-20a49b0302d0net/http: correctly close fake net.Conns + 2025-11-2032f5aadd2fcmd/compile: stack allocate backing stores during append + 2025-11-20a18aff8057runtime: select GC mark workers during start-the-world + 2025-11-20829779f4feruntime: split findRunnableGCWorker in two + 2025-11-20ab59569099go/version: use "custom" as an example of a version suffix + 2025-11-19c4bb9653bacmd/compile: Implement LoweredZeroLoop with LSX Instruction on loong64 + 2025-11-197f2ae21fb4cmd/internal/obj/loong64: add MULW.D.W[U] instructions + 2025-11-19a2946f2385crypto: add Encapsulator and Decapsulator interfaces + 2025-11-196b83bd7146crypto/ecdh: add KeyExchanger interface + 2025-11-194fef9f8b55go/types, types2: fix object path for grouped declaration statements + 2025-11-1933529db142spec: escape double-ampersands + 2025-11-19dc42565a20cmd/compile: fix control flow for unsigned divisions proof relations + 2025-11-19e64023dcbfcmd/compile: cleanup useless if statement in prove + 2025-11-192239520d1ctest: go fmt prove.go tests + 2025-11-19489d3dafb7math: switch s390x math.Pow to generic implementation + 2025-11-188c41a482f9runtime: add dlog.hexdump + 2025-11-18e912618bd2runtime: add hexdumper + 2025-11-182cf9d4b62fRevert "net/http: do not discard body content when closing it within request handlers" + 2025-11-184d0658bb08cmd/compile: prefer fixed registers for values + 2025-11-18ba634ca5c7cmd/compile: fold boolean NOT into branches + 2025-11-188806d53c10cmd/link: align sections, not symbols after DWARF compress + 2025-11-18c93766007druntime: do not print recovered when double panic with the same value + 2025-11-189859b43643cmd/asm,cmd/compile,cmd/internal/obj/riscv: use compressed instructions on riscv64 + 2025-11-17b9ef0633f6cmd/internal/sys,internal/goarch,runtime: enable the use of compressed instructions on riscv64 + 2025-11-17a087dea869debug/elf: sync new loong64 relocation types up to LoongArch ELF psABI v20250521 + 2025-11-17e1a12c781fcmd/compile: use 32x32->64 multiplies on arm64 + 2025-11-176caab99026runtime: relax TestMemoryLimit on darwin a bit more + 2025-11-17eda2e8c683runtime: clear frame pointer at thread entry points + 2025-11-176919858338runtime: rename findrunnable references to findRunnable + 2025-11-178e734ec954go/ast: fix BasicLit.End position for raw strings containing \r + 2025-11-17592775ec7dcrypto/mlkem: avoid a few unnecessary inverse NTT calls + 2025-11-17590cf18dafcrypto/mlkem/mlkemtest: add derandomized Encapsulate768/1024 + 2025-11-17c12c337099cmd/compile: teach prove about subtract idioms + 2025-11-17bc15963813cmd/compile: clean up prove pass + 2025-11-171297fae708go/token: add (*File).End method + 2025-11-1765c09eafdfruntime: hoist invariant code out of heapBitsSmallForAddrInline + 2025-11-17594129b80cinternal/runtime/maps: update doc for table.Clear + 2025-11-15c58d075e9acrypto/rsa: deprecate PKCS#1 v1.5 encryption + 2025-11-14d55ecea9e5runtime: usleep before stealing runnext only if not in syscall + 2025-11-14410ef44f00cmd: update x/tools to 59ff18c + 2025-11-1450128a2154runtime: support runtime.freegc in size-specialized mallocs for noscan objects + 2025-11-14c3708350a4cmd/go: tests: rename git-min-vers->git-sha256 + 2025-11-14aea881230dstd: fix printf("%q", int) mistakes + 2025-11-14120f1874efruntime: add more precise test of assist credit handling for runtime.freegc + 2025-11-14fecfcaa4f6runtime: add runtime.freegc to reduce GC work + 2025-11-145a347b775eruntime: set GOEXPERIMENT=runtimefreegc to disabled by default + 2025-11-141a03d0db3fruntime: skip tests for GOEXPERIMENT=arenas that do not handle clobberfree=1 + 2025-11-14cb0d9980f5net/http: do not discard body content when closing it within request handlers + 2025-11-1403ed43988fcmd/compile: allow multi-field structs to be stored directly in interfaces + 2025-11-141bb1f2bf0cruntime: put AddCleanup cleanup arguments in their own allocation + 2025-11-149fd2e44439runtime: add AddCleanup benchmark + 2025-11-1480c91eedbbruntime: ensure weak handles end up in their own allocation + 2025-11-147a8d0b5d53runtime: add debug mode to extend _Grunning-without-P windows + 2025-11-14710abf74dainternal/runtime/cgobench: add Go function call benchmark for comparison + 2025-11-14b24aec598bdoc, cmd/internal/obj/riscv: document the riscv64 assembler + 2025-11-14a0e738c657cmd/compile/internal: remove incorrect riscv64 SLTI rule + 2025-11-142cdcc4150bcmd/compile: fold negation into multiplication + 2025-11-14b57962b7c7bytes: fix panic in bytes.Buffer.Peek + 2025-11-140a569528eacmd/compile: optimize comparisons with single bit difference + 2025-11-141e5e6663e9cmd/compile: remove unnecessary casts and types from riscv64 rules + 2025-11-14ddd8558e61go/types, types2: swap object.color for Checker.objPathIdx + 2025-11-149daaab305ccmd/link/internal/ld: make runtime.buildVersion with experiments valid + 2025-11-13d50a571ddftest: fix tests to work with sizespecializedmalloc turned off + 2025-11-13704f841eabcmd/trace: annotation proc start/stop with thread and proc always + 2025-11-1317a02b9106net/http: remove unused isLitOrSingle and isNotToken + 2025-11-13ff61991aedcmd/go: fix flaky TestScript/mod_get_direct + 2025-11-13129d0cb543net/http/cgi: accept INCLUDED as protocol for server side includes + 2025-11-1377c5130100go/types: minor simplification + 2025-11-137601cd3880go/types: generate cycles.go + 2025-11-137a372affd9go/types, types2: rename definedType to declaredType and clarify docs Change-Id: Ibaa9bdb982364892f80e511c1bb12661fcd5fb86
This commit is contained in:
commit
e3d4645693
347 changed files with 10387 additions and 2812 deletions
2
api/next/73627.txt
Normal file
2
api/next/73627.txt
Normal file
|
|
@ -0,0 +1,2 @@
|
|||
pkg crypto/mlkem/mlkemtest, func Encapsulate1024(*mlkem.EncapsulationKey1024, []uint8) ([]uint8, []uint8, error) #73627
|
||||
pkg crypto/mlkem/mlkemtest, func Encapsulate768(*mlkem.EncapsulationKey768, []uint8) ([]uint8, []uint8, error) #73627
|
||||
12
api/next/75300.txt
Normal file
12
api/next/75300.txt
Normal file
|
|
@ -0,0 +1,12 @@
|
|||
pkg crypto, type Decapsulator interface { Decapsulate, Encapsulator } #75300
|
||||
pkg crypto, type Decapsulator interface, Decapsulate([]uint8) ([]uint8, error) #75300
|
||||
pkg crypto, type Decapsulator interface, Encapsulator() Encapsulator #75300
|
||||
pkg crypto, type Encapsulator interface { Bytes, Encapsulate } #75300
|
||||
pkg crypto, type Encapsulator interface, Bytes() []uint8 #75300
|
||||
pkg crypto, type Encapsulator interface, Encapsulate() ([]uint8, []uint8) #75300
|
||||
pkg crypto/ecdh, type KeyExchanger interface { Curve, ECDH, PublicKey } #75300
|
||||
pkg crypto/ecdh, type KeyExchanger interface, Curve() Curve #75300
|
||||
pkg crypto/ecdh, type KeyExchanger interface, ECDH(*PublicKey) ([]uint8, error) #75300
|
||||
pkg crypto/ecdh, type KeyExchanger interface, PublicKey() *PublicKey #75300
|
||||
pkg crypto/mlkem, method (*DecapsulationKey1024) Encapsulator() crypto.Encapsulator #75300
|
||||
pkg crypto/mlkem, method (*DecapsulationKey768) Encapsulator() crypto.Encapsulator #75300
|
||||
4
api/next/75302.txt
Normal file
4
api/next/75302.txt
Normal file
|
|
@ -0,0 +1,4 @@
|
|||
pkg crypto/rsa, func DecryptPKCS1v15 //deprecated #75302
|
||||
pkg crypto/rsa, func DecryptPKCS1v15SessionKey //deprecated #75302
|
||||
pkg crypto/rsa, func EncryptPKCS1v15 //deprecated #75302
|
||||
pkg crypto/rsa, type PKCS1v15DecryptOptions //deprecated #75302
|
||||
38
api/next/75562.txt
Normal file
38
api/next/75562.txt
Normal file
|
|
@ -0,0 +1,38 @@
|
|||
pkg debug/elf, const R_LARCH_TLS_DESC32 = 13 #75562
|
||||
pkg debug/elf, const R_LARCH_TLS_DESC32 R_LARCH #75562
|
||||
pkg debug/elf, const R_LARCH_TLS_DESC64 = 14 #75562
|
||||
pkg debug/elf, const R_LARCH_TLS_DESC64 R_LARCH #75562
|
||||
pkg debug/elf, const R_LARCH_CALL36 = 110 #75562
|
||||
pkg debug/elf, const R_LARCH_CALL36 R_LARCH #75562
|
||||
pkg debug/elf, const R_LARCH_TLS_DESC_PC_HI20 = 111 #75562
|
||||
pkg debug/elf, const R_LARCH_TLS_DESC_PC_HI20 R_LARCH #75562
|
||||
pkg debug/elf, const R_LARCH_TLS_DESC_PC_LO12 = 112 #75562
|
||||
pkg debug/elf, const R_LARCH_TLS_DESC_PC_LO12 R_LARCH #75562
|
||||
pkg debug/elf, const R_LARCH_TLS_DESC64_PC_LO20 = 113 #75562
|
||||
pkg debug/elf, const R_LARCH_TLS_DESC64_PC_LO20 R_LARCH #75562
|
||||
pkg debug/elf, const R_LARCH_TLS_DESC64_PC_HI12 = 114 #75562
|
||||
pkg debug/elf, const R_LARCH_TLS_DESC64_PC_HI12 R_LARCH #75562
|
||||
pkg debug/elf, const R_LARCH_TLS_DESC_HI20 = 115 #75562
|
||||
pkg debug/elf, const R_LARCH_TLS_DESC_HI20 R_LARCH #75562
|
||||
pkg debug/elf, const R_LARCH_TLS_DESC_LO12 = 116 #75562
|
||||
pkg debug/elf, const R_LARCH_TLS_DESC_LO12 R_LARCH #75562
|
||||
pkg debug/elf, const R_LARCH_TLS_DESC64_LO20 = 117 #75562
|
||||
pkg debug/elf, const R_LARCH_TLS_DESC64_LO20 R_LARCH #75562
|
||||
pkg debug/elf, const R_LARCH_TLS_DESC64_HI12 = 118 #75562
|
||||
pkg debug/elf, const R_LARCH_TLS_DESC64_HI12 R_LARCH #75562
|
||||
pkg debug/elf, const R_LARCH_TLS_DESC_LD = 119 #75562
|
||||
pkg debug/elf, const R_LARCH_TLS_DESC_LD R_LARCH #75562
|
||||
pkg debug/elf, const R_LARCH_TLS_DESC_CALL = 120 #75562
|
||||
pkg debug/elf, const R_LARCH_TLS_DESC_CALL R_LARCH #75562
|
||||
pkg debug/elf, const R_LARCH_TLS_LE_HI20_R = 121 #75562
|
||||
pkg debug/elf, const R_LARCH_TLS_LE_HI20_R R_LARCH #75562
|
||||
pkg debug/elf, const R_LARCH_TLS_LE_ADD_R = 122 #75562
|
||||
pkg debug/elf, const R_LARCH_TLS_LE_ADD_R R_LARCH #75562
|
||||
pkg debug/elf, const R_LARCH_TLS_LE_LO12_R = 123 #75562
|
||||
pkg debug/elf, const R_LARCH_TLS_LE_LO12_R R_LARCH #75562
|
||||
pkg debug/elf, const R_LARCH_TLS_LD_PCREL20_S2 = 124 #75562
|
||||
pkg debug/elf, const R_LARCH_TLS_LD_PCREL20_S2 R_LARCH #75562
|
||||
pkg debug/elf, const R_LARCH_TLS_GD_PCREL20_S2 = 125 #75562
|
||||
pkg debug/elf, const R_LARCH_TLS_GD_PCREL20_S2 R_LARCH #75562
|
||||
pkg debug/elf, const R_LARCH_TLS_DESC_PCREL20_S2 = 126 #75562
|
||||
pkg debug/elf, const R_LARCH_TLS_DESC_PCREL20_S2 R_LARCH #75562
|
||||
1
api/next/75849.txt
Normal file
1
api/next/75849.txt
Normal file
|
|
@ -0,0 +1 @@
|
|||
pkg go/token, method (*File) End() Pos #75849
|
||||
1
api/next/76031.txt
Normal file
1
api/next/76031.txt
Normal file
|
|
@ -0,0 +1 @@
|
|||
pkg go/ast, type BasicLit struct, ValueEnd token.Pos #76031
|
||||
|
|
@ -1039,6 +1039,12 @@ The value of <code>GOMIPS64</code> environment variable (<code>hardfloat</code>
|
|||
<code>GOMIPS64_hardfloat</code> or <code>GOMIPS64_softfloat</code>.
|
||||
</p>
|
||||
|
||||
<h3 id="riscv64">RISCV64</h3>
|
||||
|
||||
<p>
|
||||
Reference: <a href="/pkg/cmd/internal/obj/riscv">Go RISCV64 Assembly Instructions Reference Manual</a>
|
||||
</p>
|
||||
|
||||
<h3 id="unsupported_opcodes">Unsupported opcodes</h3>
|
||||
|
||||
<p>
|
||||
|
|
|
|||
|
|
@ -1,6 +1,6 @@
|
|||
<!--{
|
||||
"Title": "The Go Programming Language Specification",
|
||||
"Subtitle": "Language version go1.26 (Nov 12, 2025)",
|
||||
"Subtitle": "Language version go1.26 (Nov 18, 2025)",
|
||||
"Path": "/ref/spec"
|
||||
}-->
|
||||
|
||||
|
|
@ -2487,11 +2487,15 @@ type set[P comparable] = map[P]bool
|
|||
</pre>
|
||||
|
||||
<p>
|
||||
In an alias declaration the given type cannot be a type parameter.
|
||||
In an alias declaration the given type cannot be a type parameter declared in the same declaration.
|
||||
</p>
|
||||
|
||||
<pre>
|
||||
type A[P any] = P // illegal: P is a type parameter
|
||||
type A[P any] = P // illegal: P is a type parameter declared in the declaration of A
|
||||
|
||||
func f[P any]() {
|
||||
type A = P // ok: T is a type parameter declared by the enclosing function
|
||||
}
|
||||
</pre>
|
||||
|
||||
<h4 id="Type_definitions">Type definitions</h4>
|
||||
|
|
@ -2601,8 +2605,8 @@ In a type definition the given type cannot be a type parameter.
|
|||
<pre>
|
||||
type T[P any] P // illegal: P is a type parameter
|
||||
|
||||
func f[T any]() {
|
||||
type L T // illegal: T is a type parameter declared by the enclosing function
|
||||
func f[P any]() {
|
||||
type L P // illegal: P is a type parameter declared by the enclosing function
|
||||
}
|
||||
</pre>
|
||||
|
||||
|
|
@ -4857,7 +4861,7 @@ For instance, <code>x / y * z</code> is the same as <code>(x / y) * z</code>.
|
|||
x <= f() // x <= f()
|
||||
^a >> b // (^a) >> b
|
||||
f() || g() // f() || g()
|
||||
x == y+1 && <-chanInt > 0 // (x == (y+1)) && ((<-chanInt) > 0)
|
||||
x == y+1 && <-chanInt > 0 // (x == (y+1)) && ((<-chanInt) > 0)
|
||||
</pre>
|
||||
|
||||
|
||||
|
|
@ -6867,7 +6871,7 @@ type Tree[K cmp.Ordered, V any] struct {
|
|||
}
|
||||
|
||||
func (t *Tree[K, V]) walk(yield func(key K, val V) bool) bool {
|
||||
return t == nil || t.left.walk(yield) && yield(t.key, t.value) && t.right.walk(yield)
|
||||
return t == nil || t.left.walk(yield) && yield(t.key, t.value) && t.right.walk(yield)
|
||||
}
|
||||
|
||||
func (t *Tree[K, V]) Walk(yield func(key K, val V) bool) {
|
||||
|
|
|
|||
2
doc/next/6-stdlib/99-minor/crypto/75300.md
Normal file
2
doc/next/6-stdlib/99-minor/crypto/75300.md
Normal file
|
|
@ -0,0 +1,2 @@
|
|||
The new [Encapsulator] and [Decapsulator] interfaces allow accepting abstract
|
||||
KEM encapsulation or decapsulation keys.
|
||||
2
doc/next/6-stdlib/99-minor/crypto/ecdh/75300.md
Normal file
2
doc/next/6-stdlib/99-minor/crypto/ecdh/75300.md
Normal file
|
|
@ -0,0 +1,2 @@
|
|||
The new [KeyExchanger] interface, implemented by [PrivateKey], makes it possible
|
||||
to accept abstract ECDH private keys, e.g. those implemented in hardware.
|
||||
3
doc/next/6-stdlib/99-minor/crypto/mlkem/75300.md
Normal file
3
doc/next/6-stdlib/99-minor/crypto/mlkem/75300.md
Normal file
|
|
@ -0,0 +1,3 @@
|
|||
The new [DecapsulationKey768.Encapsulator] and
|
||||
[DecapsulationKey1024.Encapsulator] methods implement the new
|
||||
[crypto.Decapsulator] interface.
|
||||
|
|
@ -0,0 +1,3 @@
|
|||
The new [crypto/mlkem/mlkemtest] package exposes the [Encapsulate768] and
|
||||
[Encapsulate1024] functions which implement derandomized ML-KEM encapsulation,
|
||||
for use with known-answer tests.
|
||||
2
doc/next/6-stdlib/99-minor/crypto/rsa/75302.md
Normal file
2
doc/next/6-stdlib/99-minor/crypto/rsa/75302.md
Normal file
|
|
@ -0,0 +1,2 @@
|
|||
Unsafe PKCS #1 v1.5 encryption padding (implemented by [EncryptPKCS1v15],
|
||||
[DecryptPKCS1v15], and [DecryptPKCS1v15SessionKey]) is now deprecated.
|
||||
4
doc/next/6-stdlib/99-minor/debug/elf/75562.md
Normal file
4
doc/next/6-stdlib/99-minor/debug/elf/75562.md
Normal file
|
|
@ -0,0 +1,4 @@
|
|||
Additional `R_LARCH_*` constants from [LoongArch ELF psABI v20250521][laelf-20250521]
|
||||
(global version v2.40) are defined for use with LoongArch systems.
|
||||
|
||||
[laelf-20250521]: https://github.com/loongson/la-abi-specs/blob/v2.40/laelf.adoc
|
||||
5
doc/next/6-stdlib/99-minor/go/ast/76031.md
Normal file
5
doc/next/6-stdlib/99-minor/go/ast/76031.md
Normal file
|
|
@ -0,0 +1,5 @@
|
|||
The new [BasicLit.ValueEnd] field records the precise end position of
|
||||
a literal so that the [BasicLit.End] method can now always return the
|
||||
correct answer. (Previously it was computed using a heuristic that was
|
||||
incorrect for multi-line raw string literals in Windows source files,
|
||||
due to removal of carriage returns.)
|
||||
1
doc/next/6-stdlib/99-minor/go/token/75849.md
Normal file
1
doc/next/6-stdlib/99-minor/go/token/75849.md
Normal file
|
|
@ -0,0 +1 @@
|
|||
The new [File.End] convenience method returns the file's end position.
|
||||
|
|
@ -86,7 +86,7 @@ func (b *Buffer) Peek(n int) ([]byte, error) {
|
|||
if b.Len() < n {
|
||||
return b.buf[b.off:], io.EOF
|
||||
}
|
||||
return b.buf[b.off:n], nil
|
||||
return b.buf[b.off : b.off+n], nil
|
||||
}
|
||||
|
||||
// empty reports whether the unread portion of the buffer is empty.
|
||||
|
|
|
|||
|
|
@ -533,19 +533,25 @@ func TestReadString(t *testing.T) {
|
|||
|
||||
var peekTests = []struct {
|
||||
buffer string
|
||||
skip int
|
||||
n int
|
||||
expected string
|
||||
err error
|
||||
}{
|
||||
{"", 0, "", nil},
|
||||
{"aaa", 3, "aaa", nil},
|
||||
{"foobar", 2, "fo", nil},
|
||||
{"a", 2, "a", io.EOF},
|
||||
{"", 0, 0, "", nil},
|
||||
{"aaa", 0, 3, "aaa", nil},
|
||||
{"foobar", 0, 2, "fo", nil},
|
||||
{"a", 0, 2, "a", io.EOF},
|
||||
{"helloworld", 4, 3, "owo", nil},
|
||||
{"helloworld", 5, 5, "world", nil},
|
||||
{"helloworld", 5, 6, "world", io.EOF},
|
||||
{"helloworld", 10, 1, "", io.EOF},
|
||||
}
|
||||
|
||||
func TestPeek(t *testing.T) {
|
||||
for _, test := range peekTests {
|
||||
buf := NewBufferString(test.buffer)
|
||||
buf.Next(test.skip)
|
||||
bytes, err := buf.Peek(test.n)
|
||||
if string(bytes) != test.expected {
|
||||
t.Errorf("expected %q, got %q", test.expected, bytes)
|
||||
|
|
@ -553,8 +559,8 @@ func TestPeek(t *testing.T) {
|
|||
if err != test.err {
|
||||
t.Errorf("expected error %v, got %v", test.err, err)
|
||||
}
|
||||
if buf.Len() != len(test.buffer) {
|
||||
t.Errorf("bad length after peek: %d, want %d", buf.Len(), len(test.buffer))
|
||||
if buf.Len() != len(test.buffer)-test.skip {
|
||||
t.Errorf("bad length after peek: %d, want %d", buf.Len(), len(test.buffer)-test.skip)
|
||||
}
|
||||
}
|
||||
}
|
||||
|
|
|
|||
|
|
@ -169,3 +169,8 @@ TEXT ·a34(SB), 0, $0-0
|
|||
SHLXQ AX, CX, R15
|
||||
ADDQ $1, R15
|
||||
RET
|
||||
|
||||
// Ensure from3 get GOT-rewritten without errors.
|
||||
TEXT ·a35(SB), 0, $0-0
|
||||
VGF2P8AFFINEQB $0, runtime·writeBarrier(SB), Z1, Z1
|
||||
RET
|
||||
|
|
|
|||
|
|
@ -212,6 +212,12 @@ lable2:
|
|||
SRLV $32, R4, R5 // 85804500
|
||||
SRLV $32, R4 // 84804500
|
||||
|
||||
// MULW.D.W[U] instructions
|
||||
MULWVW R4, R5 // a5101f00
|
||||
MULWVW R4, R5, R6 // a6101f00
|
||||
MULWVWU R4, R5 // a5901f00
|
||||
MULWVWU R4, R5, R6 // a6901f00
|
||||
|
||||
MASKEQZ R4, R5, R6 // a6101300
|
||||
MASKNEZ R4, R5, R6 // a6901300
|
||||
|
||||
|
|
|
|||
|
|
@ -29,8 +29,9 @@ var (
|
|||
)
|
||||
|
||||
var DebugFlags struct {
|
||||
MayMoreStack string `help:"call named function before all stack growth checks"`
|
||||
PCTab string `help:"print named pc-value table\nOne of: pctospadj, pctofile, pctoline, pctoinline, pctopcdata"`
|
||||
CompressInstructions int `help:"use compressed instructions when possible (if supported by architecture)"`
|
||||
MayMoreStack string `help:"call named function before all stack growth checks"`
|
||||
PCTab string `help:"print named pc-value table\nOne of: pctospadj, pctofile, pctoline, pctoinline, pctopcdata"`
|
||||
}
|
||||
|
||||
var (
|
||||
|
|
@ -47,6 +48,8 @@ func init() {
|
|||
flag.Var(objabi.NewDebugFlag(&DebugFlags, nil), "d", "enable debugging settings; try -d help")
|
||||
objabi.AddVersionFlag() // -V
|
||||
objabi.Flagcount("S", "print assembly and machine code", &PrintOut)
|
||||
|
||||
DebugFlags.CompressInstructions = 1
|
||||
}
|
||||
|
||||
// MultiFlag allows setting a value multiple times to collect a list, as in -I=dir1 -I=dir2.
|
||||
|
|
|
|||
|
|
@ -40,6 +40,7 @@ func main() {
|
|||
log.Fatalf("unrecognized architecture %s", GOARCH)
|
||||
}
|
||||
ctxt := obj.Linknew(architecture.LinkArch)
|
||||
ctxt.CompressInstructions = flags.DebugFlags.CompressInstructions != 0
|
||||
ctxt.Debugasm = flags.PrintOut
|
||||
ctxt.Debugvlog = flags.DebugV
|
||||
ctxt.Flag_dynlink = *flags.Dynlink
|
||||
|
|
|
|||
|
|
@ -20,6 +20,7 @@ type DebugFlags struct {
|
|||
Append int `help:"print information about append compilation"`
|
||||
Checkptr int `help:"instrument unsafe pointer conversions\n0: instrumentation disabled\n1: conversions involving unsafe.Pointer are instrumented\n2: conversions to unsafe.Pointer force heap allocation" concurrent:"ok"`
|
||||
Closure int `help:"print information about closure compilation"`
|
||||
CompressInstructions int `help:"use compressed instructions when possible (if supported by architecture)"`
|
||||
Converthash string `help:"hash value for use in debugging changes to platform-dependent float-to-[u]int conversion" concurrent:"ok"`
|
||||
Defer int `help:"print information about defer compilation"`
|
||||
DisableNil int `help:"disable nil checks" concurrent:"ok"`
|
||||
|
|
|
|||
|
|
@ -177,6 +177,7 @@ func ParseFlags() {
|
|||
Flag.WB = true
|
||||
|
||||
Debug.ConcurrentOk = true
|
||||
Debug.CompressInstructions = 1
|
||||
Debug.MaxShapeLen = 500
|
||||
Debug.AlignHot = 1
|
||||
Debug.InlFuncsWithClosures = 1
|
||||
|
|
@ -299,6 +300,7 @@ func ParseFlags() {
|
|||
}
|
||||
parseSpectre(Flag.Spectre) // left as string for RecordFlags
|
||||
|
||||
Ctxt.CompressInstructions = Debug.CompressInstructions != 0
|
||||
Ctxt.Flag_shared = Ctxt.Flag_dynlink || Ctxt.Flag_shared
|
||||
Ctxt.Flag_optimize = Flag.N == 0
|
||||
Ctxt.Debugasm = int(Flag.S)
|
||||
|
|
|
|||
|
|
@ -44,6 +44,11 @@ func Funcs(fns []*ir.Func) {
|
|||
*as.lhs = ir.BlankNode
|
||||
*as.rhs = zero
|
||||
}
|
||||
if len(assigns) > 0 {
|
||||
// k.Defn might be pointing at one of the
|
||||
// assignments we're overwriting.
|
||||
k.Defn = nil
|
||||
}
|
||||
}
|
||||
}
|
||||
}
|
||||
|
|
|
|||
|
|
@ -124,3 +124,21 @@ func parseLeaks(s string) leaks {
|
|||
copy(l[:], s[4:])
|
||||
return l
|
||||
}
|
||||
|
||||
func ParseLeaks(s string) leaks {
|
||||
return parseLeaks(s)
|
||||
}
|
||||
|
||||
// Any reports whether the value flows anywhere at all.
|
||||
func (l leaks) Any() bool {
|
||||
// TODO: do mutator/callee matter?
|
||||
if l.Heap() >= 0 || l.Mutator() >= 0 || l.Callee() >= 0 {
|
||||
return true
|
||||
}
|
||||
for i := range numEscResults {
|
||||
if l.Result(i) >= 0 {
|
||||
return true
|
||||
}
|
||||
}
|
||||
return false
|
||||
}
|
||||
|
|
|
|||
|
|
@ -22,6 +22,7 @@ import (
|
|||
"cmd/compile/internal/pkginit"
|
||||
"cmd/compile/internal/reflectdata"
|
||||
"cmd/compile/internal/rttype"
|
||||
"cmd/compile/internal/slice"
|
||||
"cmd/compile/internal/ssa"
|
||||
"cmd/compile/internal/ssagen"
|
||||
"cmd/compile/internal/staticinit"
|
||||
|
|
@ -271,6 +272,8 @@ func Main(archInit func(*ssagen.ArchInfo)) {
|
|||
base.Timer.Start("fe", "escapes")
|
||||
escape.Funcs(typecheck.Target.Funcs)
|
||||
|
||||
slice.Funcs(typecheck.Target.Funcs)
|
||||
|
||||
loopvar.LogTransformations(transformed)
|
||||
|
||||
// Collect information for go:nowritebarrierrec
|
||||
|
|
|
|||
|
|
@ -192,6 +192,7 @@ type CallExpr struct {
|
|||
IsDDD bool
|
||||
GoDefer bool // whether this call is part of a go or defer statement
|
||||
NoInline bool // whether this call must not be inlined
|
||||
UseBuf bool // use stack buffer for backing store (OAPPEND only)
|
||||
}
|
||||
|
||||
func NewCallExpr(pos src.XPos, op Op, fun Node, args []Node) *CallExpr {
|
||||
|
|
@ -1280,3 +1281,28 @@ func MethodExprFunc(n Node) *types.Field {
|
|||
base.Fatalf("unexpected node: %v (%v)", n, n.Op())
|
||||
panic("unreachable")
|
||||
}
|
||||
|
||||
// A MoveToHeapExpr takes a slice as input and moves it to the
|
||||
// heap (by copying the backing store if it is not already
|
||||
// on the heap).
|
||||
type MoveToHeapExpr struct {
|
||||
miniExpr
|
||||
Slice Node
|
||||
// An expression that evaluates to a *runtime._type
|
||||
// that represents the slice element type.
|
||||
RType Node
|
||||
// If PreserveCapacity is true, the capacity of
|
||||
// the resulting slice, and all of the elements in
|
||||
// [len:cap], must be preserved.
|
||||
// If PreserveCapacity is false, the resulting
|
||||
// slice may have any capacity >= len, with any
|
||||
// elements in the resulting [len:cap] range zeroed.
|
||||
PreserveCapacity bool
|
||||
}
|
||||
|
||||
func NewMoveToHeapExpr(pos src.XPos, slice Node) *MoveToHeapExpr {
|
||||
n := &MoveToHeapExpr{Slice: slice}
|
||||
n.pos = pos
|
||||
n.op = OMOVE2HEAP
|
||||
return n
|
||||
}
|
||||
|
|
|
|||
|
|
@ -574,7 +574,7 @@ func exprFmt(n Node, s fmt.State, prec int) {
|
|||
// Special case for rune constants.
|
||||
if typ == types.RuneType || typ == types.UntypedRune {
|
||||
if x, ok := constant.Uint64Val(val); ok && x <= utf8.MaxRune {
|
||||
fmt.Fprintf(s, "%q", x)
|
||||
fmt.Fprintf(s, "%q", rune(x))
|
||||
return
|
||||
}
|
||||
}
|
||||
|
|
|
|||
|
|
@ -43,7 +43,7 @@ type Name struct {
|
|||
Func *Func // TODO(austin): nil for I.M
|
||||
Offset_ int64
|
||||
val constant.Value
|
||||
Opt any // for use by escape analysis
|
||||
Opt any // for use by escape or slice analysis
|
||||
Embed *[]Embed // list of embedded files, for ONAME var
|
||||
|
||||
// For a local variable (not param) or extern, the initializing assignment (OAS or OAS2).
|
||||
|
|
|
|||
|
|
@ -293,6 +293,7 @@ const (
|
|||
OLINKSYMOFFSET // offset within a name
|
||||
OJUMPTABLE // A jump table structure for implementing dense expression switches
|
||||
OINTERFACESWITCH // A type switch with interface cases
|
||||
OMOVE2HEAP // Promote a stack-backed slice to heap
|
||||
|
||||
// opcodes for generics
|
||||
ODYNAMICDOTTYPE // x = i.(T) where T is a type parameter (or derived from a type parameter)
|
||||
|
|
|
|||
|
|
@ -1175,6 +1175,34 @@ func (n *MakeExpr) editChildrenWithHidden(edit func(Node) Node) {
|
|||
}
|
||||
}
|
||||
|
||||
func (n *MoveToHeapExpr) Format(s fmt.State, verb rune) { fmtNode(n, s, verb) }
|
||||
func (n *MoveToHeapExpr) copy() Node {
|
||||
c := *n
|
||||
c.init = copyNodes(c.init)
|
||||
return &c
|
||||
}
|
||||
func (n *MoveToHeapExpr) doChildren(do func(Node) bool) bool {
|
||||
if doNodes(n.init, do) {
|
||||
return true
|
||||
}
|
||||
if n.Slice != nil && do(n.Slice) {
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func (n *MoveToHeapExpr) doChildrenWithHidden(do func(Node) bool) bool {
|
||||
return n.doChildren(do)
|
||||
}
|
||||
func (n *MoveToHeapExpr) editChildren(edit func(Node) Node) {
|
||||
editNodes(n.init, edit)
|
||||
if n.Slice != nil {
|
||||
n.Slice = edit(n.Slice).(Node)
|
||||
}
|
||||
}
|
||||
func (n *MoveToHeapExpr) editChildrenWithHidden(edit func(Node) Node) {
|
||||
n.editChildren(edit)
|
||||
}
|
||||
|
||||
func (n *Name) Format(s fmt.State, verb rune) { fmtNode(n, s, verb) }
|
||||
|
||||
func (n *NilExpr) Format(s fmt.State, verb rune) { fmtNode(n, s, verb) }
|
||||
|
|
|
|||
|
|
@ -151,18 +151,19 @@ func _() {
|
|||
_ = x[OLINKSYMOFFSET-140]
|
||||
_ = x[OJUMPTABLE-141]
|
||||
_ = x[OINTERFACESWITCH-142]
|
||||
_ = x[ODYNAMICDOTTYPE-143]
|
||||
_ = x[ODYNAMICDOTTYPE2-144]
|
||||
_ = x[ODYNAMICTYPE-145]
|
||||
_ = x[OTAILCALL-146]
|
||||
_ = x[OGETG-147]
|
||||
_ = x[OGETCALLERSP-148]
|
||||
_ = x[OEND-149]
|
||||
_ = x[OMOVE2HEAP-143]
|
||||
_ = x[ODYNAMICDOTTYPE-144]
|
||||
_ = x[ODYNAMICDOTTYPE2-145]
|
||||
_ = x[ODYNAMICTYPE-146]
|
||||
_ = x[OTAILCALL-147]
|
||||
_ = x[OGETG-148]
|
||||
_ = x[OGETCALLERSP-149]
|
||||
_ = x[OEND-150]
|
||||
}
|
||||
|
||||
const _Op_name = "XXXNAMENONAMETYPELITERALNILADDSUBORXORADDSTRADDRANDANDAPPENDBYTES2STRBYTES2STRTMPRUNES2STRSTR2BYTESSTR2BYTESTMPSTR2RUNESSLICE2ARRSLICE2ARRPTRASAS2AS2DOTTYPEAS2FUNCAS2MAPRAS2RECVASOPCALLCALLFUNCCALLMETHCALLINTERCAPCLEARCLOSECLOSURECOMPLITMAPLITSTRUCTLITARRAYLITSLICELITPTRLITCONVCONVIFACECONVNOPCOPYDCLDCLFUNCDELETEDOTDOTPTRDOTMETHDOTINTERXDOTDOTTYPEDOTTYPE2EQNELTLEGEGTDEREFINDEXINDEXMAPKEYSTRUCTKEYLENMAKEMAKECHANMAKEMAPMAKESLICEMAKESLICECOPYMULDIVMODLSHRSHANDANDNOTNEWNOTBITNOTPLUSNEGORORPANICPRINTPRINTLNPARENSENDSLICESLICEARRSLICESTRSLICE3SLICE3ARRSLICEHEADERSTRINGHEADERRECOVERRECVRUNESTRSELRECV2MINMAXREALIMAGCOMPLEXUNSAFEADDUNSAFESLICEUNSAFESLICEDATAUNSAFESTRINGUNSAFESTRINGDATAMETHEXPRMETHVALUEBLOCKBREAKCASECONTINUEDEFERFALLFORGOTOIFLABELGORANGERETURNSELECTSWITCHTYPESWINLCALLMAKEFACEITABIDATASPTRCFUNCCHECKNILRESULTINLMARKLINKSYMOFFSETJUMPTABLEINTERFACESWITCHDYNAMICDOTTYPEDYNAMICDOTTYPE2DYNAMICTYPETAILCALLGETGGETCALLERSPEND"
|
||||
const _Op_name = "XXXNAMENONAMETYPELITERALNILADDSUBORXORADDSTRADDRANDANDAPPENDBYTES2STRBYTES2STRTMPRUNES2STRSTR2BYTESSTR2BYTESTMPSTR2RUNESSLICE2ARRSLICE2ARRPTRASAS2AS2DOTTYPEAS2FUNCAS2MAPRAS2RECVASOPCALLCALLFUNCCALLMETHCALLINTERCAPCLEARCLOSECLOSURECOMPLITMAPLITSTRUCTLITARRAYLITSLICELITPTRLITCONVCONVIFACECONVNOPCOPYDCLDCLFUNCDELETEDOTDOTPTRDOTMETHDOTINTERXDOTDOTTYPEDOTTYPE2EQNELTLEGEGTDEREFINDEXINDEXMAPKEYSTRUCTKEYLENMAKEMAKECHANMAKEMAPMAKESLICEMAKESLICECOPYMULDIVMODLSHRSHANDANDNOTNEWNOTBITNOTPLUSNEGORORPANICPRINTPRINTLNPARENSENDSLICESLICEARRSLICESTRSLICE3SLICE3ARRSLICEHEADERSTRINGHEADERRECOVERRECVRUNESTRSELRECV2MINMAXREALIMAGCOMPLEXUNSAFEADDUNSAFESLICEUNSAFESLICEDATAUNSAFESTRINGUNSAFESTRINGDATAMETHEXPRMETHVALUEBLOCKBREAKCASECONTINUEDEFERFALLFORGOTOIFLABELGORANGERETURNSELECTSWITCHTYPESWINLCALLMAKEFACEITABIDATASPTRCFUNCCHECKNILRESULTINLMARKLINKSYMOFFSETJUMPTABLEINTERFACESWITCHMOVE2HEAPDYNAMICDOTTYPEDYNAMICDOTTYPE2DYNAMICTYPETAILCALLGETGGETCALLERSPEND"
|
||||
|
||||
var _Op_index = [...]uint16{0, 3, 7, 13, 17, 24, 27, 30, 33, 35, 38, 44, 48, 54, 60, 69, 81, 90, 99, 111, 120, 129, 141, 143, 146, 156, 163, 170, 177, 181, 185, 193, 201, 210, 213, 218, 223, 230, 237, 243, 252, 260, 268, 274, 278, 287, 294, 298, 301, 308, 314, 317, 323, 330, 338, 342, 349, 357, 359, 361, 363, 365, 367, 369, 374, 379, 387, 390, 399, 402, 406, 414, 421, 430, 443, 446, 449, 452, 455, 458, 461, 467, 470, 473, 479, 483, 486, 490, 495, 500, 507, 512, 516, 521, 529, 537, 543, 552, 563, 575, 582, 586, 593, 601, 604, 607, 611, 615, 622, 631, 642, 657, 669, 685, 693, 702, 707, 712, 716, 724, 729, 733, 736, 740, 742, 747, 749, 754, 760, 766, 772, 778, 785, 793, 797, 802, 806, 811, 819, 825, 832, 845, 854, 869, 883, 898, 909, 917, 921, 932, 935}
|
||||
var _Op_index = [...]uint16{0, 3, 7, 13, 17, 24, 27, 30, 33, 35, 38, 44, 48, 54, 60, 69, 81, 90, 99, 111, 120, 129, 141, 143, 146, 156, 163, 170, 177, 181, 185, 193, 201, 210, 213, 218, 223, 230, 237, 243, 252, 260, 268, 274, 278, 287, 294, 298, 301, 308, 314, 317, 323, 330, 338, 342, 349, 357, 359, 361, 363, 365, 367, 369, 374, 379, 387, 390, 399, 402, 406, 414, 421, 430, 443, 446, 449, 452, 455, 458, 461, 467, 470, 473, 479, 483, 486, 490, 495, 500, 507, 512, 516, 521, 529, 537, 543, 552, 563, 575, 582, 586, 593, 601, 604, 607, 611, 615, 622, 631, 642, 657, 669, 685, 693, 702, 707, 712, 716, 724, 729, 733, 736, 740, 742, 747, 749, 754, 760, 766, 772, 778, 785, 793, 797, 802, 806, 811, 819, 825, 832, 845, 854, 869, 878, 892, 907, 918, 926, 930, 941, 944}
|
||||
|
||||
func (i Op) String() string {
|
||||
if i >= Op(len(_Op_index)-1) {
|
||||
|
|
|
|||
|
|
@ -42,6 +42,7 @@ func (*Decl) isStmt() {}
|
|||
type Stmt interface {
|
||||
Node
|
||||
isStmt()
|
||||
PtrInit() *Nodes
|
||||
}
|
||||
|
||||
// A miniStmt is a miniNode with extra fields common to statements.
|
||||
|
|
|
|||
|
|
@ -29,6 +29,11 @@ type symsStruct struct {
|
|||
GCWriteBarrier [8]*obj.LSym
|
||||
Goschedguarded *obj.LSym
|
||||
Growslice *obj.LSym
|
||||
GrowsliceBuf *obj.LSym
|
||||
MoveSlice *obj.LSym
|
||||
MoveSliceNoScan *obj.LSym
|
||||
MoveSliceNoCap *obj.LSym
|
||||
MoveSliceNoCapNoScan *obj.LSym
|
||||
InterfaceSwitch *obj.LSym
|
||||
MallocGC *obj.LSym
|
||||
MallocGCSmallNoScan [27]*obj.LSym
|
||||
|
|
|
|||
|
|
@ -575,6 +575,7 @@ func ssaGenValue(s *ssagen.State, v *ssa.Value) {
|
|||
case ssa.OpLOONG64LoweredZeroLoop:
|
||||
ptrReg := v.Args[0].Reg()
|
||||
countReg := v.RegTmp()
|
||||
flagReg := int16(loong64.REGTMP)
|
||||
var off int64
|
||||
n := v.AuxInt
|
||||
loopSize := int64(64)
|
||||
|
|
@ -587,58 +588,119 @@ func ssaGenValue(s *ssagen.State, v *ssa.Value) {
|
|||
// vs
|
||||
// 16 instuctions in the straightline code
|
||||
// Might as well use straightline code.
|
||||
v.Fatalf("ZeroLoop size tool small %d", n)
|
||||
v.Fatalf("ZeroLoop size too small %d", n)
|
||||
}
|
||||
|
||||
// Put iteration count in a register.
|
||||
// MOVV $n/loopSize, countReg
|
||||
p := s.Prog(loong64.AMOVV)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = n / loopSize
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = countReg
|
||||
cntInit := p
|
||||
// MOVV $n/loopSize, countReg
|
||||
// MOVBU ir.Syms.Loong64HasLSX, flagReg
|
||||
// BNE flagReg, lsxInit
|
||||
// genericInit:
|
||||
// for off = 0; off < loopSize; off += 8 {
|
||||
// zero8(s, ptrReg, off)
|
||||
// }
|
||||
// ADDV $loopSize, ptrReg
|
||||
// SUBV $1, countReg
|
||||
// BNE countReg, genericInit
|
||||
// JMP tail
|
||||
// lsxInit:
|
||||
// VXORV V31, V31, V31, v31 = 0
|
||||
// for off = 0; off < loopSize; off += 16 {
|
||||
// zero16(s, V31, ptrReg, off)
|
||||
// }
|
||||
// ADDV $loopSize, ptrReg
|
||||
// SUBV $1, countReg
|
||||
// BNE countReg, lsxInit
|
||||
// tail:
|
||||
// n %= loopSize
|
||||
// for off = 0; n >= 8; off += 8, n -= 8 {
|
||||
// zero8(s, ptrReg, off)
|
||||
// }
|
||||
//
|
||||
// if n != 0 {
|
||||
// zero8(s, ptrReg, off+n-8)
|
||||
// }
|
||||
|
||||
// Zero loopSize bytes starting at ptrReg.
|
||||
for range loopSize / 8 {
|
||||
// MOVV ZR, off(ptrReg)
|
||||
p1 := s.Prog(loong64.AMOVV)
|
||||
p1.From.Type = obj.TYPE_CONST
|
||||
p1.From.Offset = n / loopSize
|
||||
p1.To.Type = obj.TYPE_REG
|
||||
p1.To.Reg = countReg
|
||||
|
||||
p2 := s.Prog(loong64.AMOVBU)
|
||||
p2.From.Type = obj.TYPE_MEM
|
||||
p2.From.Name = obj.NAME_EXTERN
|
||||
p2.From.Sym = ir.Syms.Loong64HasLSX
|
||||
p2.To.Type = obj.TYPE_REG
|
||||
p2.To.Reg = flagReg
|
||||
|
||||
p3 := s.Prog(loong64.ABNE)
|
||||
p3.From.Type = obj.TYPE_REG
|
||||
p3.From.Reg = flagReg
|
||||
p3.To.Type = obj.TYPE_BRANCH
|
||||
|
||||
for off = 0; off < loopSize; off += 8 {
|
||||
zero8(s, ptrReg, off)
|
||||
off += 8
|
||||
}
|
||||
|
||||
// Increment ptrReg by loopSize.
|
||||
// ADDV $loopSize, ptrReg
|
||||
p = s.Prog(loong64.AADDV)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = loopSize
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = ptrReg
|
||||
p4 := s.Prog(loong64.AADDV)
|
||||
p4.From.Type = obj.TYPE_CONST
|
||||
p4.From.Offset = loopSize
|
||||
p4.To.Type = obj.TYPE_REG
|
||||
p4.To.Reg = ptrReg
|
||||
|
||||
// Decrement loop count.
|
||||
// SUBV $1, countReg
|
||||
p = s.Prog(loong64.ASUBV)
|
||||
p.From.Type = obj.TYPE_CONST
|
||||
p.From.Offset = 1
|
||||
p.To.Type = obj.TYPE_REG
|
||||
p.To.Reg = countReg
|
||||
p5 := s.Prog(loong64.ASUBV)
|
||||
p5.From.Type = obj.TYPE_CONST
|
||||
p5.From.Offset = 1
|
||||
p5.To.Type = obj.TYPE_REG
|
||||
p5.To.Reg = countReg
|
||||
|
||||
// Jump to loop header if we're not done yet.
|
||||
// BNE countReg, loop header
|
||||
p = s.Prog(loong64.ABNE)
|
||||
p.From.Type = obj.TYPE_REG
|
||||
p.From.Reg = countReg
|
||||
p.To.Type = obj.TYPE_BRANCH
|
||||
p.To.SetTarget(cntInit.Link)
|
||||
p6 := s.Prog(loong64.ABNE)
|
||||
p6.From.Type = obj.TYPE_REG
|
||||
p6.From.Reg = countReg
|
||||
p6.To.Type = obj.TYPE_BRANCH
|
||||
p6.To.SetTarget(p3.Link)
|
||||
|
||||
p7 := s.Prog(obj.AJMP)
|
||||
p7.To.Type = obj.TYPE_BRANCH
|
||||
|
||||
p8 := s.Prog(loong64.AVXORV)
|
||||
p8.From.Type = obj.TYPE_REG
|
||||
p8.From.Reg = loong64.REG_V31
|
||||
p8.To.Type = obj.TYPE_REG
|
||||
p8.To.Reg = loong64.REG_V31
|
||||
p3.To.SetTarget(p8)
|
||||
|
||||
for off = 0; off < loopSize; off += 16 {
|
||||
zero16(s, loong64.REG_V31, ptrReg, off)
|
||||
}
|
||||
|
||||
p9 := s.Prog(loong64.AADDV)
|
||||
p9.From.Type = obj.TYPE_CONST
|
||||
p9.From.Offset = loopSize
|
||||
p9.To.Type = obj.TYPE_REG
|
||||
p9.To.Reg = ptrReg
|
||||
|
||||
p10 := s.Prog(loong64.ASUBV)
|
||||
p10.From.Type = obj.TYPE_CONST
|
||||
p10.From.Offset = 1
|
||||
p10.To.Type = obj.TYPE_REG
|
||||
p10.To.Reg = countReg
|
||||
|
||||
p11 := s.Prog(loong64.ABNE)
|
||||
p11.From.Type = obj.TYPE_REG
|
||||
p11.From.Reg = countReg
|
||||
p11.To.Type = obj.TYPE_BRANCH
|
||||
p11.To.SetTarget(p8.Link)
|
||||
|
||||
p12 := s.Prog(obj.ANOP)
|
||||
p7.To.SetTarget(p12)
|
||||
|
||||
// Multiples of the loop size are now done.
|
||||
n %= loopSize
|
||||
|
||||
off = 0
|
||||
// Write any fractional portion.
|
||||
for n >= 8 {
|
||||
// MOVV ZR, off(ptrReg)
|
||||
for off = 0; n >= 8; off += 8 {
|
||||
// MOVV ZR, off(ptrReg)
|
||||
zero8(s, ptrReg, off)
|
||||
off += 8
|
||||
n -= 8
|
||||
}
|
||||
|
||||
|
|
@ -1333,7 +1395,7 @@ func move8(s *ssagen.State, src, dst, tmp int16, off int64) {
|
|||
|
||||
// zero8 zeroes 8 bytes at reg+off.
|
||||
func zero8(s *ssagen.State, reg int16, off int64) {
|
||||
// MOVV ZR, off(reg)
|
||||
// MOVV ZR, off(reg)
|
||||
p := s.Prog(loong64.AMOVV)
|
||||
p.From.Type = obj.TYPE_REG
|
||||
p.From.Reg = loong64.REGZERO
|
||||
|
|
@ -1341,3 +1403,14 @@ func zero8(s *ssagen.State, reg int16, off int64) {
|
|||
p.To.Reg = reg
|
||||
p.To.Offset = off
|
||||
}
|
||||
|
||||
// zero16 zeroes 16 bytes at reg+off.
|
||||
func zero16(s *ssagen.State, regZero, regBase int16, off int64) {
|
||||
// VMOVQ regZero, off(regBase)
|
||||
p := s.Prog(loong64.AVMOVQ)
|
||||
p.From.Type = obj.TYPE_REG
|
||||
p.From.Reg = regZero
|
||||
p.To.Type = obj.TYPE_MEM
|
||||
p.To.Reg = regBase
|
||||
p.To.Offset = off
|
||||
}
|
||||
|
|
|
|||
455
src/cmd/compile/internal/slice/slice.go
Normal file
455
src/cmd/compile/internal/slice/slice.go
Normal file
|
|
@ -0,0 +1,455 @@
|
|||
// Copyright 2025 The Go Authors. All rights reserved.
|
||||
// Use of this source code is governed by a BSD-style
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
package slice
|
||||
|
||||
// This file implements a stack-allocation optimization
|
||||
// for the backing store of slices.
|
||||
//
|
||||
// Consider the code:
|
||||
//
|
||||
// var s []int
|
||||
// for i := range ... {
|
||||
// s = append(s, i)
|
||||
// }
|
||||
// return s
|
||||
//
|
||||
// Some of the append operations will need to do an allocation
|
||||
// by calling growslice. This will happen on the 1st, 2nd, 4th,
|
||||
// 8th, etc. append calls. The allocations done by all but the
|
||||
// last growslice call will then immediately be garbage.
|
||||
//
|
||||
// We'd like to avoid doing some of those intermediate
|
||||
// allocations if possible.
|
||||
//
|
||||
// If we can determine that the "return s" statement is the
|
||||
// *only* way that the backing store for s escapes, then we
|
||||
// can rewrite the code to something like:
|
||||
//
|
||||
// var s []int
|
||||
// for i := range N {
|
||||
// s = append(s, i)
|
||||
// }
|
||||
// s = move2heap(s)
|
||||
// return s
|
||||
//
|
||||
// Using the move2heap runtime function, which does:
|
||||
//
|
||||
// move2heap(s):
|
||||
// If s is not backed by a stackframe-allocated
|
||||
// backing store, return s. Otherwise, copy s
|
||||
// to the heap and return the copy.
|
||||
//
|
||||
// Now we can treat the backing store of s allocated at the
|
||||
// append site as not escaping. Previous stack allocation
|
||||
// optimizations now apply, which can use a fixed-size
|
||||
// stack-allocated backing store for s when appending.
|
||||
// (See ../ssagen/ssa.go:(*state).append)
|
||||
//
|
||||
// It is tricky to do this optimization safely. To describe
|
||||
// our analysis, we first define what an "exclusive" slice
|
||||
// variable is.
|
||||
//
|
||||
// A slice variable (a variable of slice type) is called
|
||||
// "exclusive" if, when it has a reference to a
|
||||
// stackframe-allocated backing store, it is the only
|
||||
// variable with such a reference.
|
||||
//
|
||||
// In other words, a slice variable is exclusive if
|
||||
// any of the following holds:
|
||||
// 1) It points to a heap-allocated backing store
|
||||
// 2) It points to a stack-allocated backing store
|
||||
// for any parent frame.
|
||||
// 3) It is the only variable that references its
|
||||
// backing store.
|
||||
// 4) It is nil.
|
||||
//
|
||||
// The nice thing about exclusive slice variables is that
|
||||
// it is always safe to do
|
||||
// s = move2heap(s)
|
||||
// whenever s is an exclusive slice variable. Because no
|
||||
// one else has a reference to the backing store, no one
|
||||
// else can tell that we moved the backing store from one
|
||||
// location to another.
|
||||
//
|
||||
// Note that exclusiveness is a dynamic property. A slice
|
||||
// variable may be exclusive during some parts of execution
|
||||
// and not exclusive during others.
|
||||
//
|
||||
// The following operations set or preserve the exclusivity
|
||||
// of a slice variable s:
|
||||
// s = nil
|
||||
// s = append(s, ...)
|
||||
// s = s[i:j]
|
||||
// ... = s[i]
|
||||
// s[i] = ...
|
||||
// f(s) where f does not escape its argument
|
||||
// Other operations destroy exclusivity. A non-exhaustive list includes:
|
||||
// x = s
|
||||
// *p = s
|
||||
// f(s) where f escapes its argument
|
||||
// return s
|
||||
// To err on the safe side, we white list exclusivity-preserving
|
||||
// operations and we asssume that any other operations that mention s
|
||||
// destroy its exclusivity.
|
||||
//
|
||||
// Our strategy is to move the backing store of s to the heap before
|
||||
// any exclusive->nonexclusive transition. That way, s will only ever
|
||||
// have a reference to a stack backing store while it is exclusive.
|
||||
//
|
||||
// move2heap for a variable s is implemented with:
|
||||
// if s points to within the stack frame {
|
||||
// s2 := make([]T, s.len, s.cap)
|
||||
// copy(s2[:s.cap], s[:s.cap])
|
||||
// s = s2
|
||||
// }
|
||||
// Note that in general we need to copy all of s[:cap(s)] elements when
|
||||
// moving to the heap. As an optimization, we keep track of slice variables
|
||||
// whose capacity, and the elements in s[len(s):cap(s)], are never accessed.
|
||||
// For those slice variables, we can allocate to the next size class above
|
||||
// the length, which saves memory and copying cost.
|
||||
|
||||
import (
|
||||
"cmd/compile/internal/base"
|
||||
"cmd/compile/internal/escape"
|
||||
"cmd/compile/internal/ir"
|
||||
"cmd/compile/internal/reflectdata"
|
||||
)
|
||||
|
||||
func Funcs(all []*ir.Func) {
|
||||
if base.Flag.N != 0 {
|
||||
return
|
||||
}
|
||||
for _, fn := range all {
|
||||
analyze(fn)
|
||||
}
|
||||
}
|
||||
|
||||
func analyze(fn *ir.Func) {
|
||||
type sliceInfo struct {
|
||||
// Slice variable.
|
||||
s *ir.Name
|
||||
|
||||
// Count of uses that this pass understands.
|
||||
okUses int32
|
||||
// Count of all uses found.
|
||||
allUses int32
|
||||
|
||||
// A place where the slice variable transitions from
|
||||
// exclusive to nonexclusive.
|
||||
// We could keep track of more than one, but one is enough for now.
|
||||
// Currently, this can be either a return statement or
|
||||
// an assignment.
|
||||
// TODO: other possible transitions?
|
||||
transition ir.Stmt
|
||||
|
||||
// Each s = append(s, ...) instance we found.
|
||||
appends []*ir.CallExpr
|
||||
|
||||
// Weight of the number of s = append(s, ...) instances we found.
|
||||
// The optimizations we do are only really useful if there are at
|
||||
// least weight 2. (Note: appends in loops have weight >= 2.)
|
||||
appendWeight int
|
||||
|
||||
// Whether we ever do cap(s), or other operations that use cap(s)
|
||||
// (possibly implicitly), like s[i:j].
|
||||
capUsed bool
|
||||
}
|
||||
|
||||
// Every variable (*ir.Name) that we are tracking will have
|
||||
// a non-nil *sliceInfo in its Opt field.
|
||||
haveLocalSlice := false
|
||||
maxStackSize := int64(base.Debug.VariableMakeThreshold)
|
||||
var namedRets []*ir.Name
|
||||
for _, s := range fn.Dcl {
|
||||
if !s.Type().IsSlice() {
|
||||
continue
|
||||
}
|
||||
if s.Type().Elem().Size() > maxStackSize {
|
||||
continue
|
||||
}
|
||||
if !base.VariableMakeHash.MatchPos(s.Pos(), nil) {
|
||||
continue
|
||||
}
|
||||
s.Opt = &sliceInfo{s: s} // start tracking s
|
||||
haveLocalSlice = true
|
||||
if s.Class == ir.PPARAMOUT {
|
||||
namedRets = append(namedRets, s)
|
||||
}
|
||||
}
|
||||
if !haveLocalSlice {
|
||||
return
|
||||
}
|
||||
|
||||
// Keep track of loop depth while walking.
|
||||
loopDepth := 0
|
||||
|
||||
// tracking returns the info for the slice variable if n is a slice
|
||||
// variable that we're still considering, or nil otherwise.
|
||||
tracking := func(n ir.Node) *sliceInfo {
|
||||
if n == nil || n.Op() != ir.ONAME {
|
||||
return nil
|
||||
}
|
||||
s := n.(*ir.Name)
|
||||
if s.Opt == nil {
|
||||
return nil
|
||||
}
|
||||
return s.Opt.(*sliceInfo)
|
||||
}
|
||||
|
||||
// addTransition(n, loc) records that s experiences an exclusive->nonexclusive
|
||||
// transition somewhere within loc.
|
||||
addTransition := func(i *sliceInfo, loc ir.Stmt) {
|
||||
if i.transition != nil {
|
||||
// We only keep track of a single exclusive->nonexclusive transition
|
||||
// for a slice variable. If we find more than one, give up.
|
||||
// (More than one transition location would be fine, but we would
|
||||
// start to get worried about introducing too much additional code.)
|
||||
i.s.Opt = nil
|
||||
return
|
||||
}
|
||||
i.transition = loc
|
||||
}
|
||||
|
||||
// Examine an x = y assignment that occurs somewhere within statement stmt.
|
||||
assign := func(x, y ir.Node, stmt ir.Stmt) {
|
||||
if i := tracking(x); i != nil {
|
||||
// s = y. Check for understood patterns for y.
|
||||
if y == nil || y.Op() == ir.ONIL {
|
||||
// s = nil is ok.
|
||||
i.okUses++
|
||||
} else if y.Op() == ir.OSLICELIT {
|
||||
// s = []{...} is ok.
|
||||
// Note: this reveals capacity. Should it?
|
||||
i.okUses++
|
||||
i.capUsed = true
|
||||
} else if y.Op() == ir.OSLICE {
|
||||
y := y.(*ir.SliceExpr)
|
||||
if y.X == i.s {
|
||||
// s = s[...:...] is ok
|
||||
i.okUses += 2
|
||||
i.capUsed = true
|
||||
}
|
||||
} else if y.Op() == ir.OAPPEND {
|
||||
y := y.(*ir.CallExpr)
|
||||
if y.Args[0] == i.s {
|
||||
// s = append(s, ...) is ok
|
||||
i.okUses += 2
|
||||
i.appends = append(i.appends, y)
|
||||
i.appendWeight += 1 + loopDepth
|
||||
}
|
||||
// TODO: s = append(nil, ...)?
|
||||
}
|
||||
// Note that technically s = make([]T, ...) preserves exclusivity, but
|
||||
// we don't track that because we assume users who wrote that know
|
||||
// better than the compiler does.
|
||||
|
||||
// TODO: figure out how to handle s = fn(..., s, ...)
|
||||
// It would be nice to maintain exclusivity of s in this situation.
|
||||
// But unfortunately, fn can return one of its other arguments, which
|
||||
// may be a slice with a stack-allocated backing store other than s.
|
||||
// (which may have preexisting references to its backing store).
|
||||
//
|
||||
// Maybe we could do it if s is the only argument?
|
||||
}
|
||||
|
||||
if i := tracking(y); i != nil {
|
||||
// ... = s
|
||||
// Treat this as an exclusive->nonexclusive transition.
|
||||
i.okUses++
|
||||
addTransition(i, stmt)
|
||||
}
|
||||
}
|
||||
|
||||
var do func(ir.Node) bool
|
||||
do = func(n ir.Node) bool {
|
||||
if n == nil {
|
||||
return false
|
||||
}
|
||||
switch n.Op() {
|
||||
case ir.ONAME:
|
||||
if i := tracking(n); i != nil {
|
||||
// A use of a slice variable. Count it.
|
||||
i.allUses++
|
||||
}
|
||||
case ir.ODCL:
|
||||
n := n.(*ir.Decl)
|
||||
if i := tracking(n.X); i != nil {
|
||||
i.okUses++
|
||||
}
|
||||
case ir.OINDEX:
|
||||
n := n.(*ir.IndexExpr)
|
||||
if i := tracking(n.X); i != nil {
|
||||
// s[i] is ok.
|
||||
i.okUses++
|
||||
}
|
||||
case ir.OLEN:
|
||||
n := n.(*ir.UnaryExpr)
|
||||
if i := tracking(n.X); i != nil {
|
||||
// len(s) is ok
|
||||
i.okUses++
|
||||
}
|
||||
case ir.OCAP:
|
||||
n := n.(*ir.UnaryExpr)
|
||||
if i := tracking(n.X); i != nil {
|
||||
// cap(s) is ok
|
||||
i.okUses++
|
||||
i.capUsed = true
|
||||
}
|
||||
case ir.OADDR:
|
||||
n := n.(*ir.AddrExpr)
|
||||
if n.X.Op() == ir.OINDEX {
|
||||
n := n.X.(*ir.IndexExpr)
|
||||
if i := tracking(n.X); i != nil {
|
||||
// &s[i] is definitely a nonexclusive transition.
|
||||
// (We need this case because s[i] is ok, but &s[i] is not.)
|
||||
i.s.Opt = nil
|
||||
}
|
||||
}
|
||||
case ir.ORETURN:
|
||||
n := n.(*ir.ReturnStmt)
|
||||
for _, x := range n.Results {
|
||||
if i := tracking(x); i != nil {
|
||||
i.okUses++
|
||||
// We go exclusive->nonexclusive here
|
||||
addTransition(i, n)
|
||||
}
|
||||
}
|
||||
if len(n.Results) == 0 {
|
||||
// Uses of named result variables are implicit here.
|
||||
for _, x := range namedRets {
|
||||
if i := tracking(x); i != nil {
|
||||
addTransition(i, n)
|
||||
}
|
||||
}
|
||||
}
|
||||
case ir.OCALLFUNC:
|
||||
n := n.(*ir.CallExpr)
|
||||
for idx, arg := range n.Args {
|
||||
if i := tracking(arg); i != nil {
|
||||
if !argLeak(n, idx) {
|
||||
// Passing s to a nonescaping arg is ok.
|
||||
i.okUses++
|
||||
i.capUsed = true
|
||||
}
|
||||
}
|
||||
}
|
||||
case ir.ORANGE:
|
||||
// Range over slice is ok.
|
||||
n := n.(*ir.RangeStmt)
|
||||
if i := tracking(n.X); i != nil {
|
||||
i.okUses++
|
||||
}
|
||||
case ir.OAS:
|
||||
n := n.(*ir.AssignStmt)
|
||||
assign(n.X, n.Y, n)
|
||||
case ir.OAS2:
|
||||
n := n.(*ir.AssignListStmt)
|
||||
for i := range len(n.Lhs) {
|
||||
assign(n.Lhs[i], n.Rhs[i], n)
|
||||
}
|
||||
case ir.OCLOSURE:
|
||||
n := n.(*ir.ClosureExpr)
|
||||
for _, v := range n.Func.ClosureVars {
|
||||
do(v.Outer)
|
||||
}
|
||||
}
|
||||
if n.Op() == ir.OFOR || n.Op() == ir.ORANGE {
|
||||
// Note: loopDepth isn't really right for init portion
|
||||
// of the for statement, but that's ok. Correctness
|
||||
// does not depend on depth info.
|
||||
loopDepth++
|
||||
defer func() { loopDepth-- }()
|
||||
}
|
||||
// Check all the children.
|
||||
ir.DoChildren(n, do)
|
||||
return false
|
||||
}
|
||||
|
||||
// Run the analysis over the whole body.
|
||||
for _, stmt := range fn.Body {
|
||||
do(stmt)
|
||||
}
|
||||
|
||||
// Process accumulated info to find slice variables
|
||||
// that we can allocate on the stack.
|
||||
for _, s := range fn.Dcl {
|
||||
if s.Opt == nil {
|
||||
continue
|
||||
}
|
||||
i := s.Opt.(*sliceInfo)
|
||||
s.Opt = nil
|
||||
if i.okUses != i.allUses {
|
||||
// Some use of i.s that don't understand lurks. Give up.
|
||||
continue
|
||||
}
|
||||
|
||||
// At this point, we've decided that we *can* do
|
||||
// the optimization.
|
||||
|
||||
if i.transition == nil {
|
||||
// Exclusive for its whole lifetime. That means it
|
||||
// didn't escape. We can already handle nonescaping
|
||||
// slices without this pass.
|
||||
continue
|
||||
}
|
||||
if i.appendWeight < 2 {
|
||||
// This optimization only really helps if there is
|
||||
// (dynamically) more than one append.
|
||||
continue
|
||||
}
|
||||
|
||||
// Commit point - at this point we've decided we *should*
|
||||
// do the optimization.
|
||||
|
||||
// Insert a move2heap operation before the exclusive->nonexclusive
|
||||
// transition.
|
||||
move := ir.NewMoveToHeapExpr(i.transition.Pos(), i.s)
|
||||
if i.capUsed {
|
||||
move.PreserveCapacity = true
|
||||
}
|
||||
move.RType = reflectdata.AppendElemRType(i.transition.Pos(), i.appends[0])
|
||||
move.SetType(i.s.Type())
|
||||
move.SetTypecheck(1)
|
||||
as := ir.NewAssignStmt(i.transition.Pos(), i.s, move)
|
||||
as.SetTypecheck(1)
|
||||
i.transition.PtrInit().Prepend(as)
|
||||
// Note: we prepend because we need to put the move2heap
|
||||
// operation first, before any other init work, as the transition
|
||||
// might occur in the init work.
|
||||
|
||||
// Now that we've inserted a move2heap operation before every
|
||||
// exclusive -> nonexclusive transition, appends can now use
|
||||
// stack backing stores.
|
||||
// (This is the whole point of this pass, to enable stack
|
||||
// allocation of append backing stores.)
|
||||
for _, a := range i.appends {
|
||||
a.SetEsc(ir.EscNone)
|
||||
if i.capUsed {
|
||||
a.UseBuf = true
|
||||
}
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
// argLeak reports if the idx'th argument to the call n escapes anywhere
|
||||
// (to the heap, another argument, return value, etc.)
|
||||
// If unknown returns true.
|
||||
func argLeak(n *ir.CallExpr, idx int) bool {
|
||||
if n.Op() != ir.OCALLFUNC {
|
||||
return true
|
||||
}
|
||||
fn := ir.StaticCalleeName(ir.StaticValue(n.Fun))
|
||||
if fn == nil {
|
||||
return true
|
||||
}
|
||||
fntype := fn.Type()
|
||||
if recv := fntype.Recv(); recv != nil {
|
||||
if idx == 0 {
|
||||
return escape.ParseLeaks(recv.Note).Any()
|
||||
}
|
||||
idx--
|
||||
}
|
||||
return escape.ParseLeaks(fntype.Params()[idx].Note).Any()
|
||||
}
|
||||
|
|
@ -156,6 +156,7 @@ func init() {
|
|||
gp11sb = regInfo{inputs: []regMask{gpspsbg}, outputs: gponly}
|
||||
gp21 = regInfo{inputs: []regMask{gp, gp}, outputs: gponly}
|
||||
gp21sp = regInfo{inputs: []regMask{gpsp, gp}, outputs: gponly}
|
||||
gp21sp2 = regInfo{inputs: []regMask{gp, gpsp}, outputs: gponly}
|
||||
gp21sb = regInfo{inputs: []regMask{gpspsbg, gpsp}, outputs: gponly}
|
||||
gp21shift = regInfo{inputs: []regMask{gp, cx}, outputs: []regMask{gp}}
|
||||
gp31shift = regInfo{inputs: []regMask{gp, gp, cx}, outputs: []regMask{gp}}
|
||||
|
|
@ -361,7 +362,7 @@ func init() {
|
|||
{name: "ADDQconstmodify", argLength: 2, reg: gpstoreconst, asm: "ADDQ", aux: "SymValAndOff", clobberFlags: true, faultOnNilArg0: true, symEffect: "Read,Write"},
|
||||
{name: "ADDLconstmodify", argLength: 2, reg: gpstoreconst, asm: "ADDL", aux: "SymValAndOff", clobberFlags: true, faultOnNilArg0: true, symEffect: "Read,Write"},
|
||||
|
||||
{name: "SUBQ", argLength: 2, reg: gp21, asm: "SUBQ", resultInArg0: true, clobberFlags: true},
|
||||
{name: "SUBQ", argLength: 2, reg: gp21sp2, asm: "SUBQ", resultInArg0: true, clobberFlags: true},
|
||||
{name: "SUBL", argLength: 2, reg: gp21, asm: "SUBL", resultInArg0: true, clobberFlags: true},
|
||||
{name: "SUBQconst", argLength: 1, reg: gp11, asm: "SUBQ", aux: "Int32", resultInArg0: true, clobberFlags: true},
|
||||
{name: "SUBLconst", argLength: 1, reg: gp11, asm: "SUBL", aux: "Int32", resultInArg0: true, clobberFlags: true},
|
||||
|
|
|
|||
|
|
@ -573,6 +573,8 @@
|
|||
(TBNZ [0] (GreaterThanF cc) yes no) => (FGT cc yes no)
|
||||
(TBNZ [0] (GreaterEqualF cc) yes no) => (FGE cc yes no)
|
||||
|
||||
(TB(Z|NZ) [0] (XORconst [1] x) yes no) => (TB(NZ|Z) [0] x yes no)
|
||||
|
||||
((EQ|NE|LT|LE|GT|GE) (CMPconst [0] z:(AND x y)) yes no) && z.Uses == 1 => ((EQ|NE|LT|LE|GT|GE) (TST x y) yes no)
|
||||
((EQ|NE|LT|LE|GT|GE) (CMPconst [0] x:(ANDconst [c] y)) yes no) && x.Uses == 1 => ((EQ|NE|LT|LE|GT|GE) (TSTconst [c] y) yes no)
|
||||
((EQ|NE|LT|LE|GT|GE) (CMPWconst [0] z:(AND x y)) yes no) && z.Uses == 1 => ((EQ|NE|LT|LE|GT|GE) (TSTW x y) yes no)
|
||||
|
|
@ -1814,3 +1816,7 @@
|
|||
|
||||
(Select0 (Mul64uover x y)) => (MUL x y)
|
||||
(Select1 (Mul64uover x y)) => (NotEqual (CMPconst (UMULH <typ.UInt64> x y) [0]))
|
||||
|
||||
// 32 mul 32 -> 64
|
||||
(MUL r:(MOVWUreg x) s:(MOVWUreg y)) && r.Uses == 1 && s.Uses == 1 => (UMULL x y)
|
||||
(MUL r:(MOVWreg x) s:(MOVWreg y)) && r.Uses == 1 && s.Uses == 1 => (MULL x y)
|
||||
|
|
|
|||
|
|
@ -743,9 +743,6 @@
|
|||
|
||||
(MULV x (MOVVconst [c])) && canMulStrengthReduce(config, c) => {mulStrengthReduce(v, x, c)}
|
||||
|
||||
(MULV (NEGV x) (MOVVconst [c])) => (MULV x (MOVVconst [-c]))
|
||||
(MULV (NEGV x) (NEGV y)) => (MULV x y)
|
||||
|
||||
(ADDV x0 x1:(SLLVconst [c] y)) && x1.Uses == 1 && c > 0 && c <= 4 => (ADDshiftLLV x0 y [c])
|
||||
|
||||
// fold constant in ADDshift op
|
||||
|
|
|
|||
|
|
@ -388,6 +388,7 @@ func init() {
|
|||
argLength: 2,
|
||||
reg: regInfo{
|
||||
inputs: []regMask{gp},
|
||||
clobbers: buildReg("F31"),
|
||||
clobbersArg0: true,
|
||||
},
|
||||
faultOnNilArg0: true,
|
||||
|
|
|
|||
|
|
@ -689,36 +689,36 @@
|
|||
(MOVDnop (MOVDconst [c])) => (MOVDconst [c])
|
||||
|
||||
// Avoid unnecessary zero and sign extension when right shifting.
|
||||
(SRAI <t> [x] (MOVWreg y)) && x >= 0 && x <= 31 => (SRAIW <t> [int64(x)] y)
|
||||
(SRLI <t> [x] (MOVWUreg y)) && x >= 0 && x <= 31 => (SRLIW <t> [int64(x)] y)
|
||||
(SRAI [x] (MOVWreg y)) && x >= 0 && x <= 31 => (SRAIW [x] y)
|
||||
(SRLI [x] (MOVWUreg y)) && x >= 0 && x <= 31 => (SRLIW [x] y)
|
||||
|
||||
// Replace right shifts that exceed size of signed type.
|
||||
(SRAI <t> [x] (MOVBreg y)) && x >= 8 => (SRAI [63] (SLLI <t> [56] y))
|
||||
(SRAI <t> [x] (MOVHreg y)) && x >= 16 => (SRAI [63] (SLLI <t> [48] y))
|
||||
(SRAI <t> [x] (MOVWreg y)) && x >= 32 => (SRAIW [31] y)
|
||||
(SRAI [x] (MOVWreg y)) && x >= 32 => (SRAIW [31] y)
|
||||
|
||||
// Eliminate right shifts that exceed size of unsigned type.
|
||||
(SRLI <t> [x] (MOVBUreg y)) && x >= 8 => (MOVDconst <t> [0])
|
||||
(SRLI <t> [x] (MOVHUreg y)) && x >= 16 => (MOVDconst <t> [0])
|
||||
(SRLI <t> [x] (MOVWUreg y)) && x >= 32 => (MOVDconst <t> [0])
|
||||
(SRLI [x] (MOVBUreg y)) && x >= 8 => (MOVDconst [0])
|
||||
(SRLI [x] (MOVHUreg y)) && x >= 16 => (MOVDconst [0])
|
||||
(SRLI [x] (MOVWUreg y)) && x >= 32 => (MOVDconst [0])
|
||||
|
||||
// Fold constant into immediate instructions where possible.
|
||||
(ADD (MOVDconst <t> [val]) x) && is32Bit(val) && !t.IsPtr() => (ADDI [val] x)
|
||||
(AND (MOVDconst [val]) x) && is32Bit(val) => (ANDI [val] x)
|
||||
(OR (MOVDconst [val]) x) && is32Bit(val) => (ORI [val] x)
|
||||
(XOR (MOVDconst [val]) x) && is32Bit(val) => (XORI [val] x)
|
||||
(ROL x (MOVDconst [val])) => (RORI [int64(int8(-val)&63)] x)
|
||||
(ROLW x (MOVDconst [val])) => (RORIW [int64(int8(-val)&31)] x)
|
||||
(ROR x (MOVDconst [val])) => (RORI [int64(val&63)] x)
|
||||
(RORW x (MOVDconst [val])) => (RORIW [int64(val&31)] x)
|
||||
(SLL x (MOVDconst [val])) => (SLLI [int64(val&63)] x)
|
||||
(SRL x (MOVDconst [val])) => (SRLI [int64(val&63)] x)
|
||||
(SLLW x (MOVDconst [val])) => (SLLIW [int64(val&31)] x)
|
||||
(SRLW x (MOVDconst [val])) => (SRLIW [int64(val&31)] x)
|
||||
(SRA x (MOVDconst [val])) => (SRAI [int64(val&63)] x)
|
||||
(SRAW x (MOVDconst [val])) => (SRAIW [int64(val&31)] x)
|
||||
(SLT x (MOVDconst [val])) && val >= -2048 && val <= 2047 => (SLTI [val] x)
|
||||
(SLTU x (MOVDconst [val])) && val >= -2048 && val <= 2047 => (SLTIU [val] x)
|
||||
(ROL x (MOVDconst [val])) => (RORI [-val&63] x)
|
||||
(ROLW x (MOVDconst [val])) => (RORIW [-val&31] x)
|
||||
(ROR x (MOVDconst [val])) => (RORI [val&63] x)
|
||||
(RORW x (MOVDconst [val])) => (RORIW [val&31] x)
|
||||
(SLL x (MOVDconst [val])) => (SLLI [val&63] x)
|
||||
(SLLW x (MOVDconst [val])) => (SLLIW [val&31] x)
|
||||
(SRL x (MOVDconst [val])) => (SRLI [val&63] x)
|
||||
(SRLW x (MOVDconst [val])) => (SRLIW [val&31] x)
|
||||
(SRA x (MOVDconst [val])) => (SRAI [val&63] x)
|
||||
(SRAW x (MOVDconst [val])) => (SRAIW [val&31] x)
|
||||
(SLT x (MOVDconst [val])) && is12Bit(val) => (SLTI [val] x)
|
||||
(SLTU x (MOVDconst [val])) && is12Bit(val) => (SLTIU [val] x)
|
||||
|
||||
// Replace negated left rotation with right rotation.
|
||||
(ROL x (NEG y)) => (ROR x y)
|
||||
|
|
@ -782,7 +782,7 @@
|
|||
(SRAI [x] (MOVDconst [y])) => (MOVDconst [int64(y) >> uint32(x)])
|
||||
|
||||
// Combine doubling via addition with shift.
|
||||
(SLLI <t> [c] (ADD x x)) && c < t.Size() * 8 - 1 => (SLLI <t> [c+1] x)
|
||||
(SLLI <t> [c] (ADD x x)) && c < t.Size() * 8 - 1 => (SLLI [c+1] x)
|
||||
(SLLI <t> [c] (ADD x x)) && c >= t.Size() * 8 - 1 => (MOVDconst [0])
|
||||
|
||||
// SLTI/SLTIU with constants.
|
||||
|
|
@ -792,7 +792,6 @@
|
|||
// SLTI/SLTIU with known outcomes.
|
||||
(SLTI [x] (ANDI [y] _)) && y >= 0 && int64(y) < int64(x) => (MOVDconst [1])
|
||||
(SLTIU [x] (ANDI [y] _)) && y >= 0 && uint64(y) < uint64(x) => (MOVDconst [1])
|
||||
(SLTI [x] (ORI [y] _)) && y >= 0 && int64(y) >= int64(x) => (MOVDconst [0])
|
||||
(SLTIU [x] (ORI [y] _)) && y >= 0 && uint64(y) >= uint64(x) => (MOVDconst [0])
|
||||
|
||||
// SLT/SLTU with known outcomes.
|
||||
|
|
|
|||
|
|
@ -97,8 +97,10 @@
|
|||
// Helpers for expand calls
|
||||
// Some of these are copied from generic.rules
|
||||
|
||||
(IMake _typ (StructMake val)) => (IMake _typ val)
|
||||
(StructSelect [0] (IData x)) => (IData x)
|
||||
(IMake _typ (StructMake ___)) => imakeOfStructMake(v)
|
||||
(StructSelect (IData x)) && v.Type.Size() > 0 => (IData x)
|
||||
(StructSelect (IData x)) && v.Type.Size() == 0 && v.Type.IsStruct() => (StructMake)
|
||||
(StructSelect (IData x)) && v.Type.Size() == 0 && v.Type.IsArray() => (ArrayMake0)
|
||||
|
||||
(StructSelect [i] x:(StructMake ___)) => x.Args[i]
|
||||
|
||||
|
|
@ -109,7 +111,7 @@
|
|||
// More annoying case: (ArraySelect[0] (StructSelect[0] isAPtr))
|
||||
// There, result of the StructSelect is an Array (not a pointer) and
|
||||
// the pre-rewrite input to the ArraySelect is a struct, not a pointer.
|
||||
(StructSelect [0] x) && x.Type.IsPtrShaped() => x
|
||||
(StructSelect x) && x.Type.IsPtrShaped() => x
|
||||
(ArraySelect [0] x) && x.Type.IsPtrShaped() => x
|
||||
|
||||
// These, too. Bits is bits.
|
||||
|
|
@ -119,6 +121,7 @@
|
|||
|
||||
(Store _ (StructMake ___) _) => rewriteStructStore(v)
|
||||
|
||||
(IMake _typ (ArrayMake1 val)) => (IMake _typ val)
|
||||
(ArraySelect (ArrayMake1 x)) => x
|
||||
(ArraySelect [0] (IData x)) => (IData x)
|
||||
|
||||
|
|
|
|||
|
|
@ -195,6 +195,11 @@
|
|||
// Convert x * -1 to -x.
|
||||
(Mul(8|16|32|64) (Const(8|16|32|64) [-1]) x) => (Neg(8|16|32|64) x)
|
||||
|
||||
// Convert -x * c to x * -c
|
||||
(Mul(8|16|32|64) (Const(8|16|32|64) <t> [c]) (Neg(8|16|32|64) x)) => (Mul(8|16|32|64) x (Const(8|16|32|64) <t> [-c]))
|
||||
|
||||
(Mul(8|16|32|64) (Neg(8|16|32|64) x) (Neg(8|16|32|64) y)) => (Mul(8|16|32|64) x y)
|
||||
|
||||
// DeMorgan's Laws
|
||||
(And(8|16|32|64) <t> (Com(8|16|32|64) x) (Com(8|16|32|64) y)) => (Com(8|16|32|64) (Or(8|16|32|64) <t> x y))
|
||||
(Or(8|16|32|64) <t> (Com(8|16|32|64) x) (Com(8|16|32|64) y)) => (Com(8|16|32|64) (And(8|16|32|64) <t> x y))
|
||||
|
|
@ -337,6 +342,12 @@
|
|||
(OrB ((Less|Leq)16U (Const16 [c]) x) (Leq16U x (Const16 [d]))) && uint16(c) >= uint16(d+1) && uint16(d+1) > uint16(d) => ((Less|Leq)16U (Const16 <x.Type> [c-d-1]) (Sub16 <x.Type> x (Const16 <x.Type> [d+1])))
|
||||
(OrB ((Less|Leq)8U (Const8 [c]) x) (Leq8U x (Const8 [d]))) && uint8(c) >= uint8(d+1) && uint8(d+1) > uint8(d) => ((Less|Leq)8U (Const8 <x.Type> [c-d-1]) (Sub8 <x.Type> x (Const8 <x.Type> [d+1])))
|
||||
|
||||
// single bit difference: ( x != c && x != d ) -> ( x|(c^d) != c )
|
||||
(AndB (Neq(64|32|16|8) x cv:(Const(64|32|16|8) [c])) (Neq(64|32|16|8) x (Const(64|32|16|8) [d]))) && c|d == c && oneBit(c^d) => (Neq(64|32|16|8) (Or(64|32|16|8) <x.Type> x (Const(64|32|16|8) <x.Type> [c^d])) cv)
|
||||
|
||||
// single bit difference: ( x == c || x == d ) -> ( x|(c^d) == c )
|
||||
(OrB (Eq(64|32|16|8) x cv:(Const(64|32|16|8) [c])) (Eq(64|32|16|8) x (Const(64|32|16|8) [d]))) && c|d == c && oneBit(c^d) => (Eq(64|32|16|8) (Or(64|32|16|8) <x.Type> x (Const(64|32|16|8) <x.Type> [c^d])) cv)
|
||||
|
||||
// NaN check: ( x != x || x (>|>=|<|<=) c ) -> ( !(c (>=|>|<=|<) x) )
|
||||
(OrB (Neq64F x x) ((Less|Leq)64F x y:(Const64F [c]))) => (Not ((Leq|Less)64F y x))
|
||||
(OrB (Neq64F x x) ((Less|Leq)64F y:(Const64F [c]) x)) => (Not ((Leq|Less)64F x y))
|
||||
|
|
@ -933,8 +944,10 @@
|
|||
@x.Block (Load <v.Type> (OffPtr <v.Type.PtrTo()> [t.FieldOff(int(i))] ptr) mem)
|
||||
|
||||
// Putting struct{*byte} and similar into direct interfaces.
|
||||
(IMake _typ (StructMake val)) => (IMake _typ val)
|
||||
(StructSelect [0] (IData x)) => (IData x)
|
||||
(IMake _typ (StructMake ___)) => imakeOfStructMake(v)
|
||||
(StructSelect (IData x)) && v.Type.Size() > 0 => (IData x)
|
||||
(StructSelect (IData x)) && v.Type.Size() == 0 && v.Type.IsStruct() => (StructMake)
|
||||
(StructSelect (IData x)) && v.Type.Size() == 0 && v.Type.IsArray() => (ArrayMake0)
|
||||
|
||||
// un-SSAable values use mem->mem copies
|
||||
(Store {t} dst (Load src mem) mem) && !CanSSA(t) =>
|
||||
|
|
@ -2222,4 +2235,4 @@
|
|||
(Neq(64|32|16) (SignExt8to(64|32|16) (CvtBoolToUint8 x)) (Const(64|32|16) [0])) => x
|
||||
(Neq(64|32|16) (SignExt8to(64|32|16) (CvtBoolToUint8 x)) (Const(64|32|16) [1])) => (Not x)
|
||||
(Eq(64|32|16) (SignExt8to(64|32|16) (CvtBoolToUint8 x)) (Const(64|32|16) [1])) => x
|
||||
(Eq(64|32|16) (SignExt8to(64|32|16) (CvtBoolToUint8 x)) (Const(64|32|16) [0])) => (Not x)
|
||||
(Eq(64|32|16) (SignExt8to(64|32|16) (CvtBoolToUint8 x)) (Const(64|32|16) [0])) => (Not x)
|
||||
|
|
|
|||
|
|
@ -426,7 +426,14 @@ func (x *expandState) decomposeAsNecessary(pos src.XPos, b *Block, a, m0 *Value,
|
|||
if a.Op == OpIMake {
|
||||
data := a.Args[1]
|
||||
for data.Op == OpStructMake || data.Op == OpArrayMake1 {
|
||||
data = data.Args[0]
|
||||
// A struct make might have a few zero-sized fields.
|
||||
// Use the pointer-y one we know is there.
|
||||
for _, a := range data.Args {
|
||||
if a.Type.Size() > 0 {
|
||||
data = a
|
||||
break
|
||||
}
|
||||
}
|
||||
}
|
||||
return x.decomposeAsNecessary(pos, b, data, mem, rc.next(data.Type))
|
||||
}
|
||||
|
|
|
|||
|
|
@ -10,7 +10,9 @@ import (
|
|||
)
|
||||
|
||||
// fuseEarly runs fuse(f, fuseTypePlain|fuseTypeIntInRange|fuseTypeNanCheck).
|
||||
func fuseEarly(f *Func) { fuse(f, fuseTypePlain|fuseTypeIntInRange|fuseTypeNanCheck) }
|
||||
func fuseEarly(f *Func) {
|
||||
fuse(f, fuseTypePlain|fuseTypeIntInRange|fuseTypeSingleBitDifference|fuseTypeNanCheck)
|
||||
}
|
||||
|
||||
// fuseLate runs fuse(f, fuseTypePlain|fuseTypeIf|fuseTypeBranchRedirect).
|
||||
func fuseLate(f *Func) { fuse(f, fuseTypePlain|fuseTypeIf|fuseTypeBranchRedirect) }
|
||||
|
|
@ -21,6 +23,7 @@ const (
|
|||
fuseTypePlain fuseType = 1 << iota
|
||||
fuseTypeIf
|
||||
fuseTypeIntInRange
|
||||
fuseTypeSingleBitDifference
|
||||
fuseTypeNanCheck
|
||||
fuseTypeBranchRedirect
|
||||
fuseTypeShortCircuit
|
||||
|
|
@ -41,6 +44,9 @@ func fuse(f *Func, typ fuseType) {
|
|||
if typ&fuseTypeIntInRange != 0 {
|
||||
changed = fuseIntInRange(b) || changed
|
||||
}
|
||||
if typ&fuseTypeSingleBitDifference != 0 {
|
||||
changed = fuseSingleBitDifference(b) || changed
|
||||
}
|
||||
if typ&fuseTypeNanCheck != 0 {
|
||||
changed = fuseNanCheck(b) || changed
|
||||
}
|
||||
|
|
|
|||
|
|
@ -19,6 +19,14 @@ func fuseNanCheck(b *Block) bool {
|
|||
return fuseComparisons(b, canOptNanCheck)
|
||||
}
|
||||
|
||||
// fuseSingleBitDifference replaces the short-circuit operators between equality checks with
|
||||
// constants that only differ by a single bit. For example, it would convert
|
||||
// `if x == 4 || x == 6 { ... }` into `if (x == 4) | (x == 6) { ... }`. Rewrite rules can
|
||||
// then optimize these using a bitwise operation, in this case generating `if x|2 == 6 { ... }`.
|
||||
func fuseSingleBitDifference(b *Block) bool {
|
||||
return fuseComparisons(b, canOptSingleBitDifference)
|
||||
}
|
||||
|
||||
// fuseComparisons looks for control graphs that match this pattern:
|
||||
//
|
||||
// p - predecessor
|
||||
|
|
@ -229,3 +237,40 @@ func canOptNanCheck(x, y *Value, op Op) bool {
|
|||
}
|
||||
return false
|
||||
}
|
||||
|
||||
// canOptSingleBitDifference returns true if x op y matches either:
|
||||
//
|
||||
// v == c || v == d
|
||||
// v != c && v != d
|
||||
//
|
||||
// Where c and d are constant values that differ by a single bit.
|
||||
func canOptSingleBitDifference(x, y *Value, op Op) bool {
|
||||
if x.Op != y.Op {
|
||||
return false
|
||||
}
|
||||
switch x.Op {
|
||||
case OpEq64, OpEq32, OpEq16, OpEq8:
|
||||
if op != OpOrB {
|
||||
return false
|
||||
}
|
||||
case OpNeq64, OpNeq32, OpNeq16, OpNeq8:
|
||||
if op != OpAndB {
|
||||
return false
|
||||
}
|
||||
default:
|
||||
return false
|
||||
}
|
||||
|
||||
xi := getConstIntArgIndex(x)
|
||||
if xi < 0 {
|
||||
return false
|
||||
}
|
||||
yi := getConstIntArgIndex(y)
|
||||
if yi < 0 {
|
||||
return false
|
||||
}
|
||||
if x.Args[xi^1] != y.Args[yi^1] {
|
||||
return false
|
||||
}
|
||||
return oneBit(x.Args[xi].AuxInt ^ y.Args[yi].AuxInt)
|
||||
}
|
||||
|
|
|
|||
|
|
@ -11481,7 +11481,7 @@ var opcodeTable = [...]opInfo{
|
|||
reg: regInfo{
|
||||
inputs: []inputInfo{
|
||||
{0, 49135}, // AX CX DX BX BP SI DI R8 R9 R10 R11 R12 R13 R15
|
||||
{1, 49135}, // AX CX DX BX BP SI DI R8 R9 R10 R11 R12 R13 R15
|
||||
{1, 49151}, // AX CX DX BX SP BP SI DI R8 R9 R10 R11 R12 R13 R15
|
||||
},
|
||||
outputs: []outputInfo{
|
||||
{0, 49135}, // AX CX DX BX BP SI DI R8 R9 R10 R11 R12 R13 R15
|
||||
|
|
@ -68770,6 +68770,7 @@ var opcodeTable = [...]opInfo{
|
|||
inputs: []inputInfo{
|
||||
{0, 1071644664}, // R4 R5 R6 R7 R8 R9 R10 R11 R12 R13 R14 R15 R16 R17 R18 R19 R20 R21 R23 R24 R25 R26 R27 R28 R29 R31
|
||||
},
|
||||
clobbers: 2305843009213693952, // F31
|
||||
clobbersArg0: true,
|
||||
},
|
||||
},
|
||||
|
|
|
|||
|
|
@ -466,57 +466,56 @@ func (ft *factsTable) initLimitForNewValue(v *Value) {
|
|||
|
||||
// signedMin records the fact that we know v is at least
|
||||
// min in the signed domain.
|
||||
func (ft *factsTable) signedMin(v *Value, min int64) bool {
|
||||
return ft.newLimit(v, limit{min: min, max: math.MaxInt64, umin: 0, umax: math.MaxUint64})
|
||||
func (ft *factsTable) signedMin(v *Value, min int64) {
|
||||
ft.newLimit(v, limit{min: min, max: math.MaxInt64, umin: 0, umax: math.MaxUint64})
|
||||
}
|
||||
|
||||
// signedMax records the fact that we know v is at most
|
||||
// max in the signed domain.
|
||||
func (ft *factsTable) signedMax(v *Value, max int64) bool {
|
||||
return ft.newLimit(v, limit{min: math.MinInt64, max: max, umin: 0, umax: math.MaxUint64})
|
||||
func (ft *factsTable) signedMax(v *Value, max int64) {
|
||||
ft.newLimit(v, limit{min: math.MinInt64, max: max, umin: 0, umax: math.MaxUint64})
|
||||
}
|
||||
func (ft *factsTable) signedMinMax(v *Value, min, max int64) bool {
|
||||
return ft.newLimit(v, limit{min: min, max: max, umin: 0, umax: math.MaxUint64})
|
||||
func (ft *factsTable) signedMinMax(v *Value, min, max int64) {
|
||||
ft.newLimit(v, limit{min: min, max: max, umin: 0, umax: math.MaxUint64})
|
||||
}
|
||||
|
||||
// setNonNegative records the fact that v is known to be non-negative.
|
||||
func (ft *factsTable) setNonNegative(v *Value) bool {
|
||||
return ft.signedMin(v, 0)
|
||||
func (ft *factsTable) setNonNegative(v *Value) {
|
||||
ft.signedMin(v, 0)
|
||||
}
|
||||
|
||||
// unsignedMin records the fact that we know v is at least
|
||||
// min in the unsigned domain.
|
||||
func (ft *factsTable) unsignedMin(v *Value, min uint64) bool {
|
||||
return ft.newLimit(v, limit{min: math.MinInt64, max: math.MaxInt64, umin: min, umax: math.MaxUint64})
|
||||
func (ft *factsTable) unsignedMin(v *Value, min uint64) {
|
||||
ft.newLimit(v, limit{min: math.MinInt64, max: math.MaxInt64, umin: min, umax: math.MaxUint64})
|
||||
}
|
||||
|
||||
// unsignedMax records the fact that we know v is at most
|
||||
// max in the unsigned domain.
|
||||
func (ft *factsTable) unsignedMax(v *Value, max uint64) bool {
|
||||
return ft.newLimit(v, limit{min: math.MinInt64, max: math.MaxInt64, umin: 0, umax: max})
|
||||
func (ft *factsTable) unsignedMax(v *Value, max uint64) {
|
||||
ft.newLimit(v, limit{min: math.MinInt64, max: math.MaxInt64, umin: 0, umax: max})
|
||||
}
|
||||
func (ft *factsTable) unsignedMinMax(v *Value, min, max uint64) bool {
|
||||
return ft.newLimit(v, limit{min: math.MinInt64, max: math.MaxInt64, umin: min, umax: max})
|
||||
func (ft *factsTable) unsignedMinMax(v *Value, min, max uint64) {
|
||||
ft.newLimit(v, limit{min: math.MinInt64, max: math.MaxInt64, umin: min, umax: max})
|
||||
}
|
||||
|
||||
func (ft *factsTable) booleanFalse(v *Value) bool {
|
||||
return ft.newLimit(v, limit{min: 0, max: 0, umin: 0, umax: 0})
|
||||
func (ft *factsTable) booleanFalse(v *Value) {
|
||||
ft.newLimit(v, limit{min: 0, max: 0, umin: 0, umax: 0})
|
||||
}
|
||||
func (ft *factsTable) booleanTrue(v *Value) bool {
|
||||
return ft.newLimit(v, limit{min: 1, max: 1, umin: 1, umax: 1})
|
||||
func (ft *factsTable) booleanTrue(v *Value) {
|
||||
ft.newLimit(v, limit{min: 1, max: 1, umin: 1, umax: 1})
|
||||
}
|
||||
func (ft *factsTable) pointerNil(v *Value) bool {
|
||||
return ft.newLimit(v, limit{min: 0, max: 0, umin: 0, umax: 0})
|
||||
func (ft *factsTable) pointerNil(v *Value) {
|
||||
ft.newLimit(v, limit{min: 0, max: 0, umin: 0, umax: 0})
|
||||
}
|
||||
func (ft *factsTable) pointerNonNil(v *Value) bool {
|
||||
func (ft *factsTable) pointerNonNil(v *Value) {
|
||||
l := noLimit
|
||||
l.umin = 1
|
||||
return ft.newLimit(v, l)
|
||||
ft.newLimit(v, l)
|
||||
}
|
||||
|
||||
// newLimit adds new limiting information for v.
|
||||
// Returns true if the new limit added any new information.
|
||||
func (ft *factsTable) newLimit(v *Value, newLim limit) bool {
|
||||
func (ft *factsTable) newLimit(v *Value, newLim limit) {
|
||||
oldLim := ft.limits[v.ID]
|
||||
|
||||
// Merge old and new information.
|
||||
|
|
@ -531,13 +530,12 @@ func (ft *factsTable) newLimit(v *Value, newLim limit) bool {
|
|||
}
|
||||
|
||||
if lim == oldLim {
|
||||
return false // nothing new to record
|
||||
return // nothing new to record
|
||||
}
|
||||
|
||||
if lim.unsat() {
|
||||
r := !ft.unsat
|
||||
ft.unsat = true
|
||||
return r
|
||||
return
|
||||
}
|
||||
|
||||
// Check for recursion. This normally happens because in unsatisfiable
|
||||
|
|
@ -548,7 +546,7 @@ func (ft *factsTable) newLimit(v *Value, newLim limit) bool {
|
|||
// the posets will not notice.
|
||||
if ft.recurseCheck[v.ID] {
|
||||
// This should only happen for unsatisfiable cases. TODO: check
|
||||
return false
|
||||
return
|
||||
}
|
||||
ft.recurseCheck[v.ID] = true
|
||||
defer func() {
|
||||
|
|
@ -713,8 +711,6 @@ func (ft *factsTable) newLimit(v *Value, newLim limit) bool {
|
|||
}
|
||||
}
|
||||
}
|
||||
|
||||
return true
|
||||
}
|
||||
|
||||
func (ft *factsTable) addOrdering(v, w *Value, d domain, r relation) {
|
||||
|
|
@ -1825,7 +1821,7 @@ func initLimit(v *Value) limit {
|
|||
return lim
|
||||
}
|
||||
|
||||
// flowLimit updates the known limits of v in ft. Returns true if anything changed.
|
||||
// flowLimit updates the known limits of v in ft.
|
||||
// flowLimit can use the ranges of input arguments.
|
||||
//
|
||||
// Note: this calculation only happens at the point the value is defined. We do not reevaluate
|
||||
|
|
@ -1838,10 +1834,10 @@ func initLimit(v *Value) limit {
|
|||
// block. We could recompute the range of v once we enter the block so
|
||||
// we know that it is 0 <= v <= 8, but we don't have a mechanism to do
|
||||
// that right now.
|
||||
func (ft *factsTable) flowLimit(v *Value) bool {
|
||||
func (ft *factsTable) flowLimit(v *Value) {
|
||||
if !v.Type.IsInteger() {
|
||||
// TODO: boolean?
|
||||
return false
|
||||
return
|
||||
}
|
||||
|
||||
// Additional limits based on opcode and argument.
|
||||
|
|
@ -1851,36 +1847,36 @@ func (ft *factsTable) flowLimit(v *Value) bool {
|
|||
// extensions
|
||||
case OpZeroExt8to64, OpZeroExt8to32, OpZeroExt8to16, OpZeroExt16to64, OpZeroExt16to32, OpZeroExt32to64:
|
||||
a := ft.limits[v.Args[0].ID]
|
||||
return ft.unsignedMinMax(v, a.umin, a.umax)
|
||||
ft.unsignedMinMax(v, a.umin, a.umax)
|
||||
case OpSignExt8to64, OpSignExt8to32, OpSignExt8to16, OpSignExt16to64, OpSignExt16to32, OpSignExt32to64:
|
||||
a := ft.limits[v.Args[0].ID]
|
||||
return ft.signedMinMax(v, a.min, a.max)
|
||||
ft.signedMinMax(v, a.min, a.max)
|
||||
case OpTrunc64to8, OpTrunc64to16, OpTrunc64to32, OpTrunc32to8, OpTrunc32to16, OpTrunc16to8:
|
||||
a := ft.limits[v.Args[0].ID]
|
||||
if a.umax <= 1<<(uint64(v.Type.Size())*8)-1 {
|
||||
return ft.unsignedMinMax(v, a.umin, a.umax)
|
||||
ft.unsignedMinMax(v, a.umin, a.umax)
|
||||
}
|
||||
|
||||
// math/bits
|
||||
case OpCtz64:
|
||||
a := ft.limits[v.Args[0].ID]
|
||||
if a.nonzero() {
|
||||
return ft.unsignedMax(v, uint64(bits.Len64(a.umax)-1))
|
||||
ft.unsignedMax(v, uint64(bits.Len64(a.umax)-1))
|
||||
}
|
||||
case OpCtz32:
|
||||
a := ft.limits[v.Args[0].ID]
|
||||
if a.nonzero() {
|
||||
return ft.unsignedMax(v, uint64(bits.Len32(uint32(a.umax))-1))
|
||||
ft.unsignedMax(v, uint64(bits.Len32(uint32(a.umax))-1))
|
||||
}
|
||||
case OpCtz16:
|
||||
a := ft.limits[v.Args[0].ID]
|
||||
if a.nonzero() {
|
||||
return ft.unsignedMax(v, uint64(bits.Len16(uint16(a.umax))-1))
|
||||
ft.unsignedMax(v, uint64(bits.Len16(uint16(a.umax))-1))
|
||||
}
|
||||
case OpCtz8:
|
||||
a := ft.limits[v.Args[0].ID]
|
||||
if a.nonzero() {
|
||||
return ft.unsignedMax(v, uint64(bits.Len8(uint8(a.umax))-1))
|
||||
ft.unsignedMax(v, uint64(bits.Len8(uint8(a.umax))-1))
|
||||
}
|
||||
|
||||
case OpPopCount64, OpPopCount32, OpPopCount16, OpPopCount8:
|
||||
|
|
@ -1889,26 +1885,26 @@ func (ft *factsTable) flowLimit(v *Value) bool {
|
|||
sharedLeadingMask := ^(uint64(1)<<changingBitsCount - 1)
|
||||
fixedBits := a.umax & sharedLeadingMask
|
||||
min := uint64(bits.OnesCount64(fixedBits))
|
||||
return ft.unsignedMinMax(v, min, min+changingBitsCount)
|
||||
ft.unsignedMinMax(v, min, min+changingBitsCount)
|
||||
|
||||
case OpBitLen64:
|
||||
a := ft.limits[v.Args[0].ID]
|
||||
return ft.unsignedMinMax(v,
|
||||
ft.unsignedMinMax(v,
|
||||
uint64(bits.Len64(a.umin)),
|
||||
uint64(bits.Len64(a.umax)))
|
||||
case OpBitLen32:
|
||||
a := ft.limits[v.Args[0].ID]
|
||||
return ft.unsignedMinMax(v,
|
||||
ft.unsignedMinMax(v,
|
||||
uint64(bits.Len32(uint32(a.umin))),
|
||||
uint64(bits.Len32(uint32(a.umax))))
|
||||
case OpBitLen16:
|
||||
a := ft.limits[v.Args[0].ID]
|
||||
return ft.unsignedMinMax(v,
|
||||
ft.unsignedMinMax(v,
|
||||
uint64(bits.Len16(uint16(a.umin))),
|
||||
uint64(bits.Len16(uint16(a.umax))))
|
||||
case OpBitLen8:
|
||||
a := ft.limits[v.Args[0].ID]
|
||||
return ft.unsignedMinMax(v,
|
||||
ft.unsignedMinMax(v,
|
||||
uint64(bits.Len8(uint8(a.umin))),
|
||||
uint64(bits.Len8(uint8(a.umax))))
|
||||
|
||||
|
|
@ -1921,43 +1917,43 @@ func (ft *factsTable) flowLimit(v *Value) bool {
|
|||
// AND can only make the value smaller.
|
||||
a := ft.limits[v.Args[0].ID]
|
||||
b := ft.limits[v.Args[1].ID]
|
||||
return ft.unsignedMax(v, min(a.umax, b.umax))
|
||||
ft.unsignedMax(v, min(a.umax, b.umax))
|
||||
case OpOr64, OpOr32, OpOr16, OpOr8:
|
||||
// OR can only make the value bigger and can't flip bits proved to be zero in both inputs.
|
||||
a := ft.limits[v.Args[0].ID]
|
||||
b := ft.limits[v.Args[1].ID]
|
||||
return ft.unsignedMinMax(v,
|
||||
ft.unsignedMinMax(v,
|
||||
max(a.umin, b.umin),
|
||||
1<<bits.Len64(a.umax|b.umax)-1)
|
||||
case OpXor64, OpXor32, OpXor16, OpXor8:
|
||||
// XOR can't flip bits that are proved to be zero in both inputs.
|
||||
a := ft.limits[v.Args[0].ID]
|
||||
b := ft.limits[v.Args[1].ID]
|
||||
return ft.unsignedMax(v, 1<<bits.Len64(a.umax|b.umax)-1)
|
||||
ft.unsignedMax(v, 1<<bits.Len64(a.umax|b.umax)-1)
|
||||
case OpCom64, OpCom32, OpCom16, OpCom8:
|
||||
a := ft.limits[v.Args[0].ID]
|
||||
return ft.newLimit(v, a.com(uint(v.Type.Size())*8))
|
||||
ft.newLimit(v, a.com(uint(v.Type.Size())*8))
|
||||
|
||||
// Arithmetic.
|
||||
case OpAdd64, OpAdd32, OpAdd16, OpAdd8:
|
||||
a := ft.limits[v.Args[0].ID]
|
||||
b := ft.limits[v.Args[1].ID]
|
||||
return ft.newLimit(v, a.add(b, uint(v.Type.Size())*8))
|
||||
ft.newLimit(v, a.add(b, uint(v.Type.Size())*8))
|
||||
case OpSub64, OpSub32, OpSub16, OpSub8:
|
||||
a := ft.limits[v.Args[0].ID]
|
||||
b := ft.limits[v.Args[1].ID]
|
||||
sub := ft.newLimit(v, a.sub(b, uint(v.Type.Size())*8))
|
||||
mod := ft.detectMod(v)
|
||||
inferred := ft.detectSliceLenRelation(v)
|
||||
return sub || mod || inferred
|
||||
ft.newLimit(v, a.sub(b, uint(v.Type.Size())*8))
|
||||
ft.detectMod(v)
|
||||
ft.detectSliceLenRelation(v)
|
||||
ft.detectSubRelations(v)
|
||||
case OpNeg64, OpNeg32, OpNeg16, OpNeg8:
|
||||
a := ft.limits[v.Args[0].ID]
|
||||
bitsize := uint(v.Type.Size()) * 8
|
||||
return ft.newLimit(v, a.com(bitsize).add(limit{min: 1, max: 1, umin: 1, umax: 1}, bitsize))
|
||||
ft.newLimit(v, a.com(bitsize).add(limit{min: 1, max: 1, umin: 1, umax: 1}, bitsize))
|
||||
case OpMul64, OpMul32, OpMul16, OpMul8:
|
||||
a := ft.limits[v.Args[0].ID]
|
||||
b := ft.limits[v.Args[1].ID]
|
||||
return ft.newLimit(v, a.mul(b, uint(v.Type.Size())*8))
|
||||
ft.newLimit(v, a.mul(b, uint(v.Type.Size())*8))
|
||||
case OpLsh64x64, OpLsh64x32, OpLsh64x16, OpLsh64x8,
|
||||
OpLsh32x64, OpLsh32x32, OpLsh32x16, OpLsh32x8,
|
||||
OpLsh16x64, OpLsh16x32, OpLsh16x16, OpLsh16x8,
|
||||
|
|
@ -1965,7 +1961,7 @@ func (ft *factsTable) flowLimit(v *Value) bool {
|
|||
a := ft.limits[v.Args[0].ID]
|
||||
b := ft.limits[v.Args[1].ID]
|
||||
bitsize := uint(v.Type.Size()) * 8
|
||||
return ft.newLimit(v, a.mul(b.exp2(bitsize), bitsize))
|
||||
ft.newLimit(v, a.mul(b.exp2(bitsize), bitsize))
|
||||
case OpRsh64x64, OpRsh64x32, OpRsh64x16, OpRsh64x8,
|
||||
OpRsh32x64, OpRsh32x32, OpRsh32x16, OpRsh32x8,
|
||||
OpRsh16x64, OpRsh16x32, OpRsh16x16, OpRsh16x8,
|
||||
|
|
@ -1979,7 +1975,7 @@ func (ft *factsTable) flowLimit(v *Value) bool {
|
|||
// Easier to compute min and max of both than to write sign logic.
|
||||
vmin := min(a.min>>b.min, a.min>>b.max)
|
||||
vmax := max(a.max>>b.min, a.max>>b.max)
|
||||
return ft.signedMinMax(v, vmin, vmax)
|
||||
ft.signedMinMax(v, vmin, vmax)
|
||||
}
|
||||
case OpRsh64Ux64, OpRsh64Ux32, OpRsh64Ux16, OpRsh64Ux8,
|
||||
OpRsh32Ux64, OpRsh32Ux32, OpRsh32Ux16, OpRsh32Ux8,
|
||||
|
|
@ -1988,7 +1984,7 @@ func (ft *factsTable) flowLimit(v *Value) bool {
|
|||
a := ft.limits[v.Args[0].ID]
|
||||
b := ft.limits[v.Args[1].ID]
|
||||
if b.min >= 0 {
|
||||
return ft.unsignedMinMax(v, a.umin>>b.max, a.umax>>b.min)
|
||||
ft.unsignedMinMax(v, a.umin>>b.max, a.umax>>b.min)
|
||||
}
|
||||
case OpDiv64, OpDiv32, OpDiv16, OpDiv8:
|
||||
a := ft.limits[v.Args[0].ID]
|
||||
|
|
@ -2008,11 +2004,11 @@ func (ft *factsTable) flowLimit(v *Value) bool {
|
|||
if b.umin > 0 {
|
||||
lim = lim.unsignedMax(a.umax / b.umin)
|
||||
}
|
||||
return ft.newLimit(v, lim)
|
||||
ft.newLimit(v, lim)
|
||||
case OpMod64, OpMod32, OpMod16, OpMod8:
|
||||
return ft.modLimit(true, v, v.Args[0], v.Args[1])
|
||||
ft.modLimit(true, v, v.Args[0], v.Args[1])
|
||||
case OpMod64u, OpMod32u, OpMod16u, OpMod8u:
|
||||
return ft.modLimit(false, v, v.Args[0], v.Args[1])
|
||||
ft.modLimit(false, v, v.Args[0], v.Args[1])
|
||||
|
||||
case OpPhi:
|
||||
// Compute the union of all the input phis.
|
||||
|
|
@ -2032,9 +2028,8 @@ func (ft *factsTable) flowLimit(v *Value) bool {
|
|||
l.umin = min(l.umin, l2.umin)
|
||||
l.umax = max(l.umax, l2.umax)
|
||||
}
|
||||
return ft.newLimit(v, l)
|
||||
ft.newLimit(v, l)
|
||||
}
|
||||
return false
|
||||
}
|
||||
|
||||
// detectSliceLenRelation matches the pattern where
|
||||
|
|
@ -2047,13 +2042,13 @@ func (ft *factsTable) flowLimit(v *Value) bool {
|
|||
//
|
||||
// Note that "index" is not useed for indexing in this pattern, but
|
||||
// in the motivating example (chunked slice iteration) it is.
|
||||
func (ft *factsTable) detectSliceLenRelation(v *Value) (inferred bool) {
|
||||
func (ft *factsTable) detectSliceLenRelation(v *Value) {
|
||||
if v.Op != OpSub64 {
|
||||
return false
|
||||
return
|
||||
}
|
||||
|
||||
if !(v.Args[0].Op == OpSliceLen || v.Args[0].Op == OpSliceCap) {
|
||||
return false
|
||||
return
|
||||
}
|
||||
|
||||
slice := v.Args[0].Args[0]
|
||||
|
|
@ -2093,13 +2088,54 @@ func (ft *factsTable) detectSliceLenRelation(v *Value) (inferred bool) {
|
|||
if K < 0 { // We hate thinking about overflow
|
||||
continue
|
||||
}
|
||||
inferred = inferred || ft.signedMin(v, K)
|
||||
ft.signedMin(v, K)
|
||||
}
|
||||
}
|
||||
|
||||
// v must be Sub{64,32,16,8}.
|
||||
func (ft *factsTable) detectSubRelations(v *Value) {
|
||||
// v = x-y
|
||||
x := v.Args[0]
|
||||
y := v.Args[1]
|
||||
if x == y {
|
||||
ft.signedMinMax(v, 0, 0)
|
||||
return
|
||||
}
|
||||
xLim := ft.limits[x.ID]
|
||||
yLim := ft.limits[y.ID]
|
||||
|
||||
// Check if we might wrap around. If so, give up.
|
||||
width := uint(v.Type.Size()) * 8
|
||||
if _, ok := safeSub(xLim.min, yLim.max, width); !ok {
|
||||
return // x-y might underflow
|
||||
}
|
||||
if _, ok := safeSub(xLim.max, yLim.min, width); !ok {
|
||||
return // x-y might overflow
|
||||
}
|
||||
|
||||
// Subtracting a positive number only makes
|
||||
// things smaller.
|
||||
if yLim.min >= 0 {
|
||||
ft.update(v.Block, v, x, signed, lt|eq)
|
||||
// TODO: is this worth it?
|
||||
//if yLim.min > 0 {
|
||||
// ft.update(v.Block, v, x, signed, lt)
|
||||
//}
|
||||
}
|
||||
|
||||
// Subtracting a number from a bigger one
|
||||
// can't go below 0.
|
||||
if ft.orderS.OrderedOrEqual(y, x) {
|
||||
ft.setNonNegative(v)
|
||||
// TODO: is this worth it?
|
||||
//if ft.orderS.Ordered(y, x) {
|
||||
// ft.signedMin(v, 1)
|
||||
//}
|
||||
}
|
||||
return inferred
|
||||
}
|
||||
|
||||
// x%d has been rewritten to x - (x/d)*d.
|
||||
func (ft *factsTable) detectMod(v *Value) bool {
|
||||
func (ft *factsTable) detectMod(v *Value) {
|
||||
var opDiv, opDivU, opMul, opConst Op
|
||||
switch v.Op {
|
||||
case OpSub64:
|
||||
|
|
@ -2126,36 +2162,37 @@ func (ft *factsTable) detectMod(v *Value) bool {
|
|||
|
||||
mul := v.Args[1]
|
||||
if mul.Op != opMul {
|
||||
return false
|
||||
return
|
||||
}
|
||||
div, con := mul.Args[0], mul.Args[1]
|
||||
if div.Op == opConst {
|
||||
div, con = con, div
|
||||
}
|
||||
if con.Op != opConst || (div.Op != opDiv && div.Op != opDivU) || div.Args[0] != v.Args[0] || div.Args[1].Op != opConst || div.Args[1].AuxInt != con.AuxInt {
|
||||
return false
|
||||
return
|
||||
}
|
||||
return ft.modLimit(div.Op == opDiv, v, v.Args[0], con)
|
||||
ft.modLimit(div.Op == opDiv, v, v.Args[0], con)
|
||||
}
|
||||
|
||||
// modLimit sets v with facts derived from v = p % q.
|
||||
func (ft *factsTable) modLimit(signed bool, v, p, q *Value) bool {
|
||||
func (ft *factsTable) modLimit(signed bool, v, p, q *Value) {
|
||||
a := ft.limits[p.ID]
|
||||
b := ft.limits[q.ID]
|
||||
if signed {
|
||||
if a.min < 0 && b.min > 0 {
|
||||
return ft.signedMinMax(v, -(b.max - 1), b.max-1)
|
||||
ft.signedMinMax(v, -(b.max - 1), b.max-1)
|
||||
return
|
||||
}
|
||||
if !(a.nonnegative() && b.nonnegative()) {
|
||||
// TODO: we could handle signed limits but I didn't bother.
|
||||
return false
|
||||
return
|
||||
}
|
||||
if a.min >= 0 && b.min > 0 {
|
||||
ft.setNonNegative(v)
|
||||
}
|
||||
}
|
||||
// Underflow in the arithmetic below is ok, it gives to MaxUint64 which does nothing to the limit.
|
||||
return ft.unsignedMax(v, min(a.umax, b.umax-1))
|
||||
ft.unsignedMax(v, min(a.umax, b.umax-1))
|
||||
}
|
||||
|
||||
// getBranch returns the range restrictions added by p
|
||||
|
|
@ -2466,15 +2503,13 @@ func addLocalFacts(ft *factsTable, b *Block) {
|
|||
xl := ft.limits[x.ID]
|
||||
y := add.Args[1]
|
||||
yl := ft.limits[y.ID]
|
||||
if unsignedAddOverflows(xl.umax, yl.umax, add.Type) {
|
||||
continue
|
||||
}
|
||||
|
||||
if xl.umax < uminDivisor {
|
||||
ft.update(b, v, y, unsigned, lt|eq)
|
||||
}
|
||||
if yl.umax < uminDivisor {
|
||||
ft.update(b, v, x, unsigned, lt|eq)
|
||||
if !unsignedAddOverflows(xl.umax, yl.umax, add.Type) {
|
||||
if xl.umax < uminDivisor {
|
||||
ft.update(b, v, y, unsigned, lt|eq)
|
||||
}
|
||||
if yl.umax < uminDivisor {
|
||||
ft.update(b, v, x, unsigned, lt|eq)
|
||||
}
|
||||
}
|
||||
}
|
||||
ft.update(b, v, v.Args[0], unsigned, lt|eq)
|
||||
|
|
@ -2993,16 +3028,14 @@ func (ft *factsTable) topoSortValuesInBlock(b *Block) {
|
|||
want := f.NumValues()
|
||||
|
||||
scores := ft.reusedTopoSortScoresTable
|
||||
if len(scores) < want {
|
||||
if want <= cap(scores) {
|
||||
scores = scores[:want]
|
||||
} else {
|
||||
if cap(scores) > 0 {
|
||||
f.Cache.freeUintSlice(scores)
|
||||
}
|
||||
scores = f.Cache.allocUintSlice(want)
|
||||
ft.reusedTopoSortScoresTable = scores
|
||||
if want <= cap(scores) {
|
||||
scores = scores[:want]
|
||||
} else {
|
||||
if cap(scores) > 0 {
|
||||
f.Cache.freeUintSlice(scores)
|
||||
}
|
||||
scores = f.Cache.allocUintSlice(want)
|
||||
ft.reusedTopoSortScoresTable = scores
|
||||
}
|
||||
|
||||
for _, v := range b.Values {
|
||||
|
|
|
|||
|
|
@ -596,17 +596,18 @@ func (s *regAllocState) allocValToReg(v *Value, mask regMask, nospill bool, pos
|
|||
var c *Value
|
||||
if vi.regs != 0 {
|
||||
// Copy from a register that v is already in.
|
||||
r2 := pickReg(vi.regs)
|
||||
var current *Value
|
||||
if !s.allocatable.contains(r2) {
|
||||
current = v // v is in a fixed register
|
||||
if vi.regs&^s.allocatable != 0 {
|
||||
// v is in a fixed register, prefer that
|
||||
current = v
|
||||
} else {
|
||||
r2 := pickReg(vi.regs)
|
||||
if s.regs[r2].v != v {
|
||||
panic("bad register state")
|
||||
}
|
||||
current = s.regs[r2].c
|
||||
s.usedSinceBlockStart |= regMask(1) << r2
|
||||
}
|
||||
s.usedSinceBlockStart |= regMask(1) << r2
|
||||
c = s.curBlock.NewValue1(pos, OpCopy, v.Type, current)
|
||||
} else if v.rematerializeable() {
|
||||
// Rematerialize instead of loading from the spill location.
|
||||
|
|
|
|||
|
|
@ -2772,3 +2772,17 @@ func panicBoundsCCToAux(p PanicBoundsCC) Aux {
|
|||
func isDictArgSym(sym Sym) bool {
|
||||
return sym.(*ir.Name).Sym().Name == typecheck.LocalDictName
|
||||
}
|
||||
|
||||
// When v is (IMake typ (StructMake ...)), convert to
|
||||
// (IMake typ arg) where arg is the pointer-y argument to
|
||||
// the StructMake (there must be exactly one).
|
||||
func imakeOfStructMake(v *Value) *Value {
|
||||
var arg *Value
|
||||
for _, a := range v.Args[1].Args {
|
||||
if a.Type.Size() > 0 {
|
||||
arg = a
|
||||
break
|
||||
}
|
||||
}
|
||||
return v.Block.NewValue2(v.Pos, OpIMake, v.Type, v.Args[0], arg)
|
||||
}
|
||||
|
|
|
|||
|
|
@ -12556,6 +12556,54 @@ func rewriteValueARM64_OpARM64MUL(v *Value) bool {
|
|||
}
|
||||
break
|
||||
}
|
||||
// match: (MUL r:(MOVWUreg x) s:(MOVWUreg y))
|
||||
// cond: r.Uses == 1 && s.Uses == 1
|
||||
// result: (UMULL x y)
|
||||
for {
|
||||
for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
|
||||
r := v_0
|
||||
if r.Op != OpARM64MOVWUreg {
|
||||
continue
|
||||
}
|
||||
x := r.Args[0]
|
||||
s := v_1
|
||||
if s.Op != OpARM64MOVWUreg {
|
||||
continue
|
||||
}
|
||||
y := s.Args[0]
|
||||
if !(r.Uses == 1 && s.Uses == 1) {
|
||||
continue
|
||||
}
|
||||
v.reset(OpARM64UMULL)
|
||||
v.AddArg2(x, y)
|
||||
return true
|
||||
}
|
||||
break
|
||||
}
|
||||
// match: (MUL r:(MOVWreg x) s:(MOVWreg y))
|
||||
// cond: r.Uses == 1 && s.Uses == 1
|
||||
// result: (MULL x y)
|
||||
for {
|
||||
for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
|
||||
r := v_0
|
||||
if r.Op != OpARM64MOVWreg {
|
||||
continue
|
||||
}
|
||||
x := r.Args[0]
|
||||
s := v_1
|
||||
if s.Op != OpARM64MOVWreg {
|
||||
continue
|
||||
}
|
||||
y := s.Args[0]
|
||||
if !(r.Uses == 1 && s.Uses == 1) {
|
||||
continue
|
||||
}
|
||||
v.reset(OpARM64MULL)
|
||||
v.AddArg2(x, y)
|
||||
return true
|
||||
}
|
||||
break
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueARM64_OpARM64MULW(v *Value) bool {
|
||||
|
|
@ -25273,6 +25321,37 @@ func rewriteBlockARM64(b *Block) bool {
|
|||
b.resetWithControl(BlockARM64FGE, cc)
|
||||
return true
|
||||
}
|
||||
// match: (TBNZ [0] (XORconst [1] x) yes no)
|
||||
// result: (TBZ [0] x yes no)
|
||||
for b.Controls[0].Op == OpARM64XORconst {
|
||||
v_0 := b.Controls[0]
|
||||
if auxIntToInt64(v_0.AuxInt) != 1 {
|
||||
break
|
||||
}
|
||||
x := v_0.Args[0]
|
||||
if auxIntToInt64(b.AuxInt) != 0 {
|
||||
break
|
||||
}
|
||||
b.resetWithControl(BlockARM64TBZ, x)
|
||||
b.AuxInt = int64ToAuxInt(0)
|
||||
return true
|
||||
}
|
||||
case BlockARM64TBZ:
|
||||
// match: (TBZ [0] (XORconst [1] x) yes no)
|
||||
// result: (TBNZ [0] x yes no)
|
||||
for b.Controls[0].Op == OpARM64XORconst {
|
||||
v_0 := b.Controls[0]
|
||||
if auxIntToInt64(v_0.AuxInt) != 1 {
|
||||
break
|
||||
}
|
||||
x := v_0.Args[0]
|
||||
if auxIntToInt64(b.AuxInt) != 0 {
|
||||
break
|
||||
}
|
||||
b.resetWithControl(BlockARM64TBNZ, x)
|
||||
b.AuxInt = int64ToAuxInt(0)
|
||||
return true
|
||||
}
|
||||
case BlockARM64UGE:
|
||||
// match: (UGE (FlagConstant [fc]) yes no)
|
||||
// cond: fc.uge()
|
||||
|
|
|
|||
|
|
@ -5866,7 +5866,6 @@ func rewriteValueLOONG64_OpLOONG64MULV(v *Value) bool {
|
|||
v_0 := v.Args[0]
|
||||
b := v.Block
|
||||
config := b.Func.Config
|
||||
typ := &b.Func.Config.Types
|
||||
// match: (MULV _ (MOVVconst [0]))
|
||||
// result: (MOVVconst [0])
|
||||
for {
|
||||
|
|
@ -5911,44 +5910,6 @@ func rewriteValueLOONG64_OpLOONG64MULV(v *Value) bool {
|
|||
}
|
||||
break
|
||||
}
|
||||
// match: (MULV (NEGV x) (MOVVconst [c]))
|
||||
// result: (MULV x (MOVVconst [-c]))
|
||||
for {
|
||||
for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
|
||||
if v_0.Op != OpLOONG64NEGV {
|
||||
continue
|
||||
}
|
||||
x := v_0.Args[0]
|
||||
if v_1.Op != OpLOONG64MOVVconst {
|
||||
continue
|
||||
}
|
||||
c := auxIntToInt64(v_1.AuxInt)
|
||||
v.reset(OpLOONG64MULV)
|
||||
v0 := b.NewValue0(v.Pos, OpLOONG64MOVVconst, typ.UInt64)
|
||||
v0.AuxInt = int64ToAuxInt(-c)
|
||||
v.AddArg2(x, v0)
|
||||
return true
|
||||
}
|
||||
break
|
||||
}
|
||||
// match: (MULV (NEGV x) (NEGV y))
|
||||
// result: (MULV x y)
|
||||
for {
|
||||
for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
|
||||
if v_0.Op != OpLOONG64NEGV {
|
||||
continue
|
||||
}
|
||||
x := v_0.Args[0]
|
||||
if v_1.Op != OpLOONG64NEGV {
|
||||
continue
|
||||
}
|
||||
y := v_1.Args[0]
|
||||
v.reset(OpLOONG64MULV)
|
||||
v.AddArg2(x, y)
|
||||
return true
|
||||
}
|
||||
break
|
||||
}
|
||||
// match: (MULV (MOVVconst [c]) (MOVVconst [d]))
|
||||
// result: (MOVVconst [c*d])
|
||||
for {
|
||||
|
|
|
|||
|
|
@ -7027,7 +7027,7 @@ func rewriteValueRISCV64_OpRISCV64ROL(v *Value) bool {
|
|||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (ROL x (MOVDconst [val]))
|
||||
// result: (RORI [int64(int8(-val)&63)] x)
|
||||
// result: (RORI [-val&63] x)
|
||||
for {
|
||||
x := v_0
|
||||
if v_1.Op != OpRISCV64MOVDconst {
|
||||
|
|
@ -7035,7 +7035,7 @@ func rewriteValueRISCV64_OpRISCV64ROL(v *Value) bool {
|
|||
}
|
||||
val := auxIntToInt64(v_1.AuxInt)
|
||||
v.reset(OpRISCV64RORI)
|
||||
v.AuxInt = int64ToAuxInt(int64(int8(-val) & 63))
|
||||
v.AuxInt = int64ToAuxInt(-val & 63)
|
||||
v.AddArg(x)
|
||||
return true
|
||||
}
|
||||
|
|
@ -7057,7 +7057,7 @@ func rewriteValueRISCV64_OpRISCV64ROLW(v *Value) bool {
|
|||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (ROLW x (MOVDconst [val]))
|
||||
// result: (RORIW [int64(int8(-val)&31)] x)
|
||||
// result: (RORIW [-val&31] x)
|
||||
for {
|
||||
x := v_0
|
||||
if v_1.Op != OpRISCV64MOVDconst {
|
||||
|
|
@ -7065,7 +7065,7 @@ func rewriteValueRISCV64_OpRISCV64ROLW(v *Value) bool {
|
|||
}
|
||||
val := auxIntToInt64(v_1.AuxInt)
|
||||
v.reset(OpRISCV64RORIW)
|
||||
v.AuxInt = int64ToAuxInt(int64(int8(-val) & 31))
|
||||
v.AuxInt = int64ToAuxInt(-val & 31)
|
||||
v.AddArg(x)
|
||||
return true
|
||||
}
|
||||
|
|
@ -7087,7 +7087,7 @@ func rewriteValueRISCV64_OpRISCV64ROR(v *Value) bool {
|
|||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (ROR x (MOVDconst [val]))
|
||||
// result: (RORI [int64(val&63)] x)
|
||||
// result: (RORI [val&63] x)
|
||||
for {
|
||||
x := v_0
|
||||
if v_1.Op != OpRISCV64MOVDconst {
|
||||
|
|
@ -7095,7 +7095,7 @@ func rewriteValueRISCV64_OpRISCV64ROR(v *Value) bool {
|
|||
}
|
||||
val := auxIntToInt64(v_1.AuxInt)
|
||||
v.reset(OpRISCV64RORI)
|
||||
v.AuxInt = int64ToAuxInt(int64(val & 63))
|
||||
v.AuxInt = int64ToAuxInt(val & 63)
|
||||
v.AddArg(x)
|
||||
return true
|
||||
}
|
||||
|
|
@ -7105,7 +7105,7 @@ func rewriteValueRISCV64_OpRISCV64RORW(v *Value) bool {
|
|||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (RORW x (MOVDconst [val]))
|
||||
// result: (RORIW [int64(val&31)] x)
|
||||
// result: (RORIW [val&31] x)
|
||||
for {
|
||||
x := v_0
|
||||
if v_1.Op != OpRISCV64MOVDconst {
|
||||
|
|
@ -7113,7 +7113,7 @@ func rewriteValueRISCV64_OpRISCV64RORW(v *Value) bool {
|
|||
}
|
||||
val := auxIntToInt64(v_1.AuxInt)
|
||||
v.reset(OpRISCV64RORIW)
|
||||
v.AuxInt = int64ToAuxInt(int64(val & 31))
|
||||
v.AuxInt = int64ToAuxInt(val & 31)
|
||||
v.AddArg(x)
|
||||
return true
|
||||
}
|
||||
|
|
@ -7212,7 +7212,7 @@ func rewriteValueRISCV64_OpRISCV64SLL(v *Value) bool {
|
|||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (SLL x (MOVDconst [val]))
|
||||
// result: (SLLI [int64(val&63)] x)
|
||||
// result: (SLLI [val&63] x)
|
||||
for {
|
||||
x := v_0
|
||||
if v_1.Op != OpRISCV64MOVDconst {
|
||||
|
|
@ -7220,7 +7220,7 @@ func rewriteValueRISCV64_OpRISCV64SLL(v *Value) bool {
|
|||
}
|
||||
val := auxIntToInt64(v_1.AuxInt)
|
||||
v.reset(OpRISCV64SLLI)
|
||||
v.AuxInt = int64ToAuxInt(int64(val & 63))
|
||||
v.AuxInt = int64ToAuxInt(val & 63)
|
||||
v.AddArg(x)
|
||||
return true
|
||||
}
|
||||
|
|
@ -7246,7 +7246,7 @@ func rewriteValueRISCV64_OpRISCV64SLLI(v *Value) bool {
|
|||
}
|
||||
// match: (SLLI <t> [c] (ADD x x))
|
||||
// cond: c < t.Size() * 8 - 1
|
||||
// result: (SLLI <t> [c+1] x)
|
||||
// result: (SLLI [c+1] x)
|
||||
for {
|
||||
t := v.Type
|
||||
c := auxIntToInt64(v.AuxInt)
|
||||
|
|
@ -7258,7 +7258,6 @@ func rewriteValueRISCV64_OpRISCV64SLLI(v *Value) bool {
|
|||
break
|
||||
}
|
||||
v.reset(OpRISCV64SLLI)
|
||||
v.Type = t
|
||||
v.AuxInt = int64ToAuxInt(c + 1)
|
||||
v.AddArg(x)
|
||||
return true
|
||||
|
|
@ -7286,7 +7285,7 @@ func rewriteValueRISCV64_OpRISCV64SLLW(v *Value) bool {
|
|||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (SLLW x (MOVDconst [val]))
|
||||
// result: (SLLIW [int64(val&31)] x)
|
||||
// result: (SLLIW [val&31] x)
|
||||
for {
|
||||
x := v_0
|
||||
if v_1.Op != OpRISCV64MOVDconst {
|
||||
|
|
@ -7294,7 +7293,7 @@ func rewriteValueRISCV64_OpRISCV64SLLW(v *Value) bool {
|
|||
}
|
||||
val := auxIntToInt64(v_1.AuxInt)
|
||||
v.reset(OpRISCV64SLLIW)
|
||||
v.AuxInt = int64ToAuxInt(int64(val & 31))
|
||||
v.AuxInt = int64ToAuxInt(val & 31)
|
||||
v.AddArg(x)
|
||||
return true
|
||||
}
|
||||
|
|
@ -7304,7 +7303,7 @@ func rewriteValueRISCV64_OpRISCV64SLT(v *Value) bool {
|
|||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (SLT x (MOVDconst [val]))
|
||||
// cond: val >= -2048 && val <= 2047
|
||||
// cond: is12Bit(val)
|
||||
// result: (SLTI [val] x)
|
||||
for {
|
||||
x := v_0
|
||||
|
|
@ -7312,7 +7311,7 @@ func rewriteValueRISCV64_OpRISCV64SLT(v *Value) bool {
|
|||
break
|
||||
}
|
||||
val := auxIntToInt64(v_1.AuxInt)
|
||||
if !(val >= -2048 && val <= 2047) {
|
||||
if !(is12Bit(val)) {
|
||||
break
|
||||
}
|
||||
v.reset(OpRISCV64SLTI)
|
||||
|
|
@ -7363,22 +7362,6 @@ func rewriteValueRISCV64_OpRISCV64SLTI(v *Value) bool {
|
|||
v.AuxInt = int64ToAuxInt(1)
|
||||
return true
|
||||
}
|
||||
// match: (SLTI [x] (ORI [y] _))
|
||||
// cond: y >= 0 && int64(y) >= int64(x)
|
||||
// result: (MOVDconst [0])
|
||||
for {
|
||||
x := auxIntToInt64(v.AuxInt)
|
||||
if v_0.Op != OpRISCV64ORI {
|
||||
break
|
||||
}
|
||||
y := auxIntToInt64(v_0.AuxInt)
|
||||
if !(y >= 0 && int64(y) >= int64(x)) {
|
||||
break
|
||||
}
|
||||
v.reset(OpRISCV64MOVDconst)
|
||||
v.AuxInt = int64ToAuxInt(0)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValueRISCV64_OpRISCV64SLTIU(v *Value) bool {
|
||||
|
|
@ -7433,7 +7416,7 @@ func rewriteValueRISCV64_OpRISCV64SLTU(v *Value) bool {
|
|||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (SLTU x (MOVDconst [val]))
|
||||
// cond: val >= -2048 && val <= 2047
|
||||
// cond: is12Bit(val)
|
||||
// result: (SLTIU [val] x)
|
||||
for {
|
||||
x := v_0
|
||||
|
|
@ -7441,7 +7424,7 @@ func rewriteValueRISCV64_OpRISCV64SLTU(v *Value) bool {
|
|||
break
|
||||
}
|
||||
val := auxIntToInt64(v_1.AuxInt)
|
||||
if !(val >= -2048 && val <= 2047) {
|
||||
if !(is12Bit(val)) {
|
||||
break
|
||||
}
|
||||
v.reset(OpRISCV64SLTIU)
|
||||
|
|
@ -7555,7 +7538,7 @@ func rewriteValueRISCV64_OpRISCV64SRA(v *Value) bool {
|
|||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (SRA x (MOVDconst [val]))
|
||||
// result: (SRAI [int64(val&63)] x)
|
||||
// result: (SRAI [val&63] x)
|
||||
for {
|
||||
x := v_0
|
||||
if v_1.Op != OpRISCV64MOVDconst {
|
||||
|
|
@ -7563,7 +7546,7 @@ func rewriteValueRISCV64_OpRISCV64SRA(v *Value) bool {
|
|||
}
|
||||
val := auxIntToInt64(v_1.AuxInt)
|
||||
v.reset(OpRISCV64SRAI)
|
||||
v.AuxInt = int64ToAuxInt(int64(val & 63))
|
||||
v.AuxInt = int64ToAuxInt(val & 63)
|
||||
v.AddArg(x)
|
||||
return true
|
||||
}
|
||||
|
|
@ -7572,11 +7555,10 @@ func rewriteValueRISCV64_OpRISCV64SRA(v *Value) bool {
|
|||
func rewriteValueRISCV64_OpRISCV64SRAI(v *Value) bool {
|
||||
v_0 := v.Args[0]
|
||||
b := v.Block
|
||||
// match: (SRAI <t> [x] (MOVWreg y))
|
||||
// match: (SRAI [x] (MOVWreg y))
|
||||
// cond: x >= 0 && x <= 31
|
||||
// result: (SRAIW <t> [int64(x)] y)
|
||||
// result: (SRAIW [x] y)
|
||||
for {
|
||||
t := v.Type
|
||||
x := auxIntToInt64(v.AuxInt)
|
||||
if v_0.Op != OpRISCV64MOVWreg {
|
||||
break
|
||||
|
|
@ -7586,8 +7568,7 @@ func rewriteValueRISCV64_OpRISCV64SRAI(v *Value) bool {
|
|||
break
|
||||
}
|
||||
v.reset(OpRISCV64SRAIW)
|
||||
v.Type = t
|
||||
v.AuxInt = int64ToAuxInt(int64(x))
|
||||
v.AuxInt = int64ToAuxInt(x)
|
||||
v.AddArg(y)
|
||||
return true
|
||||
}
|
||||
|
|
@ -7633,7 +7614,7 @@ func rewriteValueRISCV64_OpRISCV64SRAI(v *Value) bool {
|
|||
v.AddArg(v0)
|
||||
return true
|
||||
}
|
||||
// match: (SRAI <t> [x] (MOVWreg y))
|
||||
// match: (SRAI [x] (MOVWreg y))
|
||||
// cond: x >= 32
|
||||
// result: (SRAIW [31] y)
|
||||
for {
|
||||
|
|
@ -7668,7 +7649,7 @@ func rewriteValueRISCV64_OpRISCV64SRAW(v *Value) bool {
|
|||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (SRAW x (MOVDconst [val]))
|
||||
// result: (SRAIW [int64(val&31)] x)
|
||||
// result: (SRAIW [val&31] x)
|
||||
for {
|
||||
x := v_0
|
||||
if v_1.Op != OpRISCV64MOVDconst {
|
||||
|
|
@ -7676,7 +7657,7 @@ func rewriteValueRISCV64_OpRISCV64SRAW(v *Value) bool {
|
|||
}
|
||||
val := auxIntToInt64(v_1.AuxInt)
|
||||
v.reset(OpRISCV64SRAIW)
|
||||
v.AuxInt = int64ToAuxInt(int64(val & 31))
|
||||
v.AuxInt = int64ToAuxInt(val & 31)
|
||||
v.AddArg(x)
|
||||
return true
|
||||
}
|
||||
|
|
@ -7686,7 +7667,7 @@ func rewriteValueRISCV64_OpRISCV64SRL(v *Value) bool {
|
|||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (SRL x (MOVDconst [val]))
|
||||
// result: (SRLI [int64(val&63)] x)
|
||||
// result: (SRLI [val&63] x)
|
||||
for {
|
||||
x := v_0
|
||||
if v_1.Op != OpRISCV64MOVDconst {
|
||||
|
|
@ -7694,7 +7675,7 @@ func rewriteValueRISCV64_OpRISCV64SRL(v *Value) bool {
|
|||
}
|
||||
val := auxIntToInt64(v_1.AuxInt)
|
||||
v.reset(OpRISCV64SRLI)
|
||||
v.AuxInt = int64ToAuxInt(int64(val & 63))
|
||||
v.AuxInt = int64ToAuxInt(val & 63)
|
||||
v.AddArg(x)
|
||||
return true
|
||||
}
|
||||
|
|
@ -7702,11 +7683,10 @@ func rewriteValueRISCV64_OpRISCV64SRL(v *Value) bool {
|
|||
}
|
||||
func rewriteValueRISCV64_OpRISCV64SRLI(v *Value) bool {
|
||||
v_0 := v.Args[0]
|
||||
// match: (SRLI <t> [x] (MOVWUreg y))
|
||||
// match: (SRLI [x] (MOVWUreg y))
|
||||
// cond: x >= 0 && x <= 31
|
||||
// result: (SRLIW <t> [int64(x)] y)
|
||||
// result: (SRLIW [x] y)
|
||||
for {
|
||||
t := v.Type
|
||||
x := auxIntToInt64(v.AuxInt)
|
||||
if v_0.Op != OpRISCV64MOVWUreg {
|
||||
break
|
||||
|
|
@ -7716,16 +7696,14 @@ func rewriteValueRISCV64_OpRISCV64SRLI(v *Value) bool {
|
|||
break
|
||||
}
|
||||
v.reset(OpRISCV64SRLIW)
|
||||
v.Type = t
|
||||
v.AuxInt = int64ToAuxInt(int64(x))
|
||||
v.AuxInt = int64ToAuxInt(x)
|
||||
v.AddArg(y)
|
||||
return true
|
||||
}
|
||||
// match: (SRLI <t> [x] (MOVBUreg y))
|
||||
// match: (SRLI [x] (MOVBUreg y))
|
||||
// cond: x >= 8
|
||||
// result: (MOVDconst <t> [0])
|
||||
// result: (MOVDconst [0])
|
||||
for {
|
||||
t := v.Type
|
||||
x := auxIntToInt64(v.AuxInt)
|
||||
if v_0.Op != OpRISCV64MOVBUreg {
|
||||
break
|
||||
|
|
@ -7734,15 +7712,13 @@ func rewriteValueRISCV64_OpRISCV64SRLI(v *Value) bool {
|
|||
break
|
||||
}
|
||||
v.reset(OpRISCV64MOVDconst)
|
||||
v.Type = t
|
||||
v.AuxInt = int64ToAuxInt(0)
|
||||
return true
|
||||
}
|
||||
// match: (SRLI <t> [x] (MOVHUreg y))
|
||||
// match: (SRLI [x] (MOVHUreg y))
|
||||
// cond: x >= 16
|
||||
// result: (MOVDconst <t> [0])
|
||||
// result: (MOVDconst [0])
|
||||
for {
|
||||
t := v.Type
|
||||
x := auxIntToInt64(v.AuxInt)
|
||||
if v_0.Op != OpRISCV64MOVHUreg {
|
||||
break
|
||||
|
|
@ -7751,15 +7727,13 @@ func rewriteValueRISCV64_OpRISCV64SRLI(v *Value) bool {
|
|||
break
|
||||
}
|
||||
v.reset(OpRISCV64MOVDconst)
|
||||
v.Type = t
|
||||
v.AuxInt = int64ToAuxInt(0)
|
||||
return true
|
||||
}
|
||||
// match: (SRLI <t> [x] (MOVWUreg y))
|
||||
// match: (SRLI [x] (MOVWUreg y))
|
||||
// cond: x >= 32
|
||||
// result: (MOVDconst <t> [0])
|
||||
// result: (MOVDconst [0])
|
||||
for {
|
||||
t := v.Type
|
||||
x := auxIntToInt64(v.AuxInt)
|
||||
if v_0.Op != OpRISCV64MOVWUreg {
|
||||
break
|
||||
|
|
@ -7768,7 +7742,6 @@ func rewriteValueRISCV64_OpRISCV64SRLI(v *Value) bool {
|
|||
break
|
||||
}
|
||||
v.reset(OpRISCV64MOVDconst)
|
||||
v.Type = t
|
||||
v.AuxInt = int64ToAuxInt(0)
|
||||
return true
|
||||
}
|
||||
|
|
@ -7790,7 +7763,7 @@ func rewriteValueRISCV64_OpRISCV64SRLW(v *Value) bool {
|
|||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (SRLW x (MOVDconst [val]))
|
||||
// result: (SRLIW [int64(val&31)] x)
|
||||
// result: (SRLIW [val&31] x)
|
||||
for {
|
||||
x := v_0
|
||||
if v_1.Op != OpRISCV64MOVDconst {
|
||||
|
|
@ -7798,7 +7771,7 @@ func rewriteValueRISCV64_OpRISCV64SRLW(v *Value) bool {
|
|||
}
|
||||
val := auxIntToInt64(v_1.AuxInt)
|
||||
v.reset(OpRISCV64SRLIW)
|
||||
v.AuxInt = int64ToAuxInt(int64(val & 31))
|
||||
v.AuxInt = int64ToAuxInt(val & 31)
|
||||
v.AddArg(x)
|
||||
return true
|
||||
}
|
||||
|
|
|
|||
|
|
@ -279,11 +279,20 @@ func rewriteValuedec_OpIData(v *Value) bool {
|
|||
func rewriteValuedec_OpIMake(v *Value) bool {
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (IMake _typ (StructMake val))
|
||||
// match: (IMake _typ (StructMake ___))
|
||||
// result: imakeOfStructMake(v)
|
||||
for {
|
||||
if v_1.Op != OpStructMake {
|
||||
break
|
||||
}
|
||||
v.copyOf(imakeOfStructMake(v))
|
||||
return true
|
||||
}
|
||||
// match: (IMake _typ (ArrayMake1 val))
|
||||
// result: (IMake _typ val)
|
||||
for {
|
||||
_typ := v_0
|
||||
if v_1.Op != OpStructMake || len(v_1.Args) != 1 {
|
||||
if v_1.Op != OpArrayMake1 {
|
||||
break
|
||||
}
|
||||
val := v_1.Args[0]
|
||||
|
|
@ -839,17 +848,47 @@ func rewriteValuedec_OpStructMake(v *Value) bool {
|
|||
func rewriteValuedec_OpStructSelect(v *Value) bool {
|
||||
v_0 := v.Args[0]
|
||||
b := v.Block
|
||||
// match: (StructSelect [0] (IData x))
|
||||
// match: (StructSelect (IData x))
|
||||
// cond: v.Type.Size() > 0
|
||||
// result: (IData x)
|
||||
for {
|
||||
if auxIntToInt64(v.AuxInt) != 0 || v_0.Op != OpIData {
|
||||
if v_0.Op != OpIData {
|
||||
break
|
||||
}
|
||||
x := v_0.Args[0]
|
||||
if !(v.Type.Size() > 0) {
|
||||
break
|
||||
}
|
||||
v.reset(OpIData)
|
||||
v.AddArg(x)
|
||||
return true
|
||||
}
|
||||
// match: (StructSelect (IData x))
|
||||
// cond: v.Type.Size() == 0 && v.Type.IsStruct()
|
||||
// result: (StructMake)
|
||||
for {
|
||||
if v_0.Op != OpIData {
|
||||
break
|
||||
}
|
||||
if !(v.Type.Size() == 0 && v.Type.IsStruct()) {
|
||||
break
|
||||
}
|
||||
v.reset(OpStructMake)
|
||||
return true
|
||||
}
|
||||
// match: (StructSelect (IData x))
|
||||
// cond: v.Type.Size() == 0 && v.Type.IsArray()
|
||||
// result: (ArrayMake0)
|
||||
for {
|
||||
if v_0.Op != OpIData {
|
||||
break
|
||||
}
|
||||
if !(v.Type.Size() == 0 && v.Type.IsArray()) {
|
||||
break
|
||||
}
|
||||
v.reset(OpArrayMake0)
|
||||
return true
|
||||
}
|
||||
// match: (StructSelect [i] x:(StructMake ___))
|
||||
// result: x.Args[i]
|
||||
for {
|
||||
|
|
@ -861,13 +900,10 @@ func rewriteValuedec_OpStructSelect(v *Value) bool {
|
|||
v.copyOf(x.Args[i])
|
||||
return true
|
||||
}
|
||||
// match: (StructSelect [0] x)
|
||||
// match: (StructSelect x)
|
||||
// cond: x.Type.IsPtrShaped()
|
||||
// result: x
|
||||
for {
|
||||
if auxIntToInt64(v.AuxInt) != 0 {
|
||||
break
|
||||
}
|
||||
x := v_0
|
||||
if !(x.Type.IsPtrShaped()) {
|
||||
break
|
||||
|
|
|
|||
|
|
@ -5332,6 +5332,182 @@ func rewriteValuegeneric_OpAndB(v *Value) bool {
|
|||
}
|
||||
break
|
||||
}
|
||||
// match: (AndB (Neq64 x cv:(Const64 [c])) (Neq64 x (Const64 [d])))
|
||||
// cond: c|d == c && oneBit(c^d)
|
||||
// result: (Neq64 (Or64 <x.Type> x (Const64 <x.Type> [c^d])) cv)
|
||||
for {
|
||||
for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
|
||||
if v_0.Op != OpNeq64 {
|
||||
continue
|
||||
}
|
||||
_ = v_0.Args[1]
|
||||
v_0_0 := v_0.Args[0]
|
||||
v_0_1 := v_0.Args[1]
|
||||
for _i1 := 0; _i1 <= 1; _i1, v_0_0, v_0_1 = _i1+1, v_0_1, v_0_0 {
|
||||
x := v_0_0
|
||||
cv := v_0_1
|
||||
if cv.Op != OpConst64 {
|
||||
continue
|
||||
}
|
||||
c := auxIntToInt64(cv.AuxInt)
|
||||
if v_1.Op != OpNeq64 {
|
||||
continue
|
||||
}
|
||||
_ = v_1.Args[1]
|
||||
v_1_0 := v_1.Args[0]
|
||||
v_1_1 := v_1.Args[1]
|
||||
for _i2 := 0; _i2 <= 1; _i2, v_1_0, v_1_1 = _i2+1, v_1_1, v_1_0 {
|
||||
if x != v_1_0 || v_1_1.Op != OpConst64 {
|
||||
continue
|
||||
}
|
||||
d := auxIntToInt64(v_1_1.AuxInt)
|
||||
if !(c|d == c && oneBit(c^d)) {
|
||||
continue
|
||||
}
|
||||
v.reset(OpNeq64)
|
||||
v0 := b.NewValue0(v.Pos, OpOr64, x.Type)
|
||||
v1 := b.NewValue0(v.Pos, OpConst64, x.Type)
|
||||
v1.AuxInt = int64ToAuxInt(c ^ d)
|
||||
v0.AddArg2(x, v1)
|
||||
v.AddArg2(v0, cv)
|
||||
return true
|
||||
}
|
||||
}
|
||||
}
|
||||
break
|
||||
}
|
||||
// match: (AndB (Neq32 x cv:(Const32 [c])) (Neq32 x (Const32 [d])))
|
||||
// cond: c|d == c && oneBit(c^d)
|
||||
// result: (Neq32 (Or32 <x.Type> x (Const32 <x.Type> [c^d])) cv)
|
||||
for {
|
||||
for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
|
||||
if v_0.Op != OpNeq32 {
|
||||
continue
|
||||
}
|
||||
_ = v_0.Args[1]
|
||||
v_0_0 := v_0.Args[0]
|
||||
v_0_1 := v_0.Args[1]
|
||||
for _i1 := 0; _i1 <= 1; _i1, v_0_0, v_0_1 = _i1+1, v_0_1, v_0_0 {
|
||||
x := v_0_0
|
||||
cv := v_0_1
|
||||
if cv.Op != OpConst32 {
|
||||
continue
|
||||
}
|
||||
c := auxIntToInt32(cv.AuxInt)
|
||||
if v_1.Op != OpNeq32 {
|
||||
continue
|
||||
}
|
||||
_ = v_1.Args[1]
|
||||
v_1_0 := v_1.Args[0]
|
||||
v_1_1 := v_1.Args[1]
|
||||
for _i2 := 0; _i2 <= 1; _i2, v_1_0, v_1_1 = _i2+1, v_1_1, v_1_0 {
|
||||
if x != v_1_0 || v_1_1.Op != OpConst32 {
|
||||
continue
|
||||
}
|
||||
d := auxIntToInt32(v_1_1.AuxInt)
|
||||
if !(c|d == c && oneBit(c^d)) {
|
||||
continue
|
||||
}
|
||||
v.reset(OpNeq32)
|
||||
v0 := b.NewValue0(v.Pos, OpOr32, x.Type)
|
||||
v1 := b.NewValue0(v.Pos, OpConst32, x.Type)
|
||||
v1.AuxInt = int32ToAuxInt(c ^ d)
|
||||
v0.AddArg2(x, v1)
|
||||
v.AddArg2(v0, cv)
|
||||
return true
|
||||
}
|
||||
}
|
||||
}
|
||||
break
|
||||
}
|
||||
// match: (AndB (Neq16 x cv:(Const16 [c])) (Neq16 x (Const16 [d])))
|
||||
// cond: c|d == c && oneBit(c^d)
|
||||
// result: (Neq16 (Or16 <x.Type> x (Const16 <x.Type> [c^d])) cv)
|
||||
for {
|
||||
for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
|
||||
if v_0.Op != OpNeq16 {
|
||||
continue
|
||||
}
|
||||
_ = v_0.Args[1]
|
||||
v_0_0 := v_0.Args[0]
|
||||
v_0_1 := v_0.Args[1]
|
||||
for _i1 := 0; _i1 <= 1; _i1, v_0_0, v_0_1 = _i1+1, v_0_1, v_0_0 {
|
||||
x := v_0_0
|
||||
cv := v_0_1
|
||||
if cv.Op != OpConst16 {
|
||||
continue
|
||||
}
|
||||
c := auxIntToInt16(cv.AuxInt)
|
||||
if v_1.Op != OpNeq16 {
|
||||
continue
|
||||
}
|
||||
_ = v_1.Args[1]
|
||||
v_1_0 := v_1.Args[0]
|
||||
v_1_1 := v_1.Args[1]
|
||||
for _i2 := 0; _i2 <= 1; _i2, v_1_0, v_1_1 = _i2+1, v_1_1, v_1_0 {
|
||||
if x != v_1_0 || v_1_1.Op != OpConst16 {
|
||||
continue
|
||||
}
|
||||
d := auxIntToInt16(v_1_1.AuxInt)
|
||||
if !(c|d == c && oneBit(c^d)) {
|
||||
continue
|
||||
}
|
||||
v.reset(OpNeq16)
|
||||
v0 := b.NewValue0(v.Pos, OpOr16, x.Type)
|
||||
v1 := b.NewValue0(v.Pos, OpConst16, x.Type)
|
||||
v1.AuxInt = int16ToAuxInt(c ^ d)
|
||||
v0.AddArg2(x, v1)
|
||||
v.AddArg2(v0, cv)
|
||||
return true
|
||||
}
|
||||
}
|
||||
}
|
||||
break
|
||||
}
|
||||
// match: (AndB (Neq8 x cv:(Const8 [c])) (Neq8 x (Const8 [d])))
|
||||
// cond: c|d == c && oneBit(c^d)
|
||||
// result: (Neq8 (Or8 <x.Type> x (Const8 <x.Type> [c^d])) cv)
|
||||
for {
|
||||
for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
|
||||
if v_0.Op != OpNeq8 {
|
||||
continue
|
||||
}
|
||||
_ = v_0.Args[1]
|
||||
v_0_0 := v_0.Args[0]
|
||||
v_0_1 := v_0.Args[1]
|
||||
for _i1 := 0; _i1 <= 1; _i1, v_0_0, v_0_1 = _i1+1, v_0_1, v_0_0 {
|
||||
x := v_0_0
|
||||
cv := v_0_1
|
||||
if cv.Op != OpConst8 {
|
||||
continue
|
||||
}
|
||||
c := auxIntToInt8(cv.AuxInt)
|
||||
if v_1.Op != OpNeq8 {
|
||||
continue
|
||||
}
|
||||
_ = v_1.Args[1]
|
||||
v_1_0 := v_1.Args[0]
|
||||
v_1_1 := v_1.Args[1]
|
||||
for _i2 := 0; _i2 <= 1; _i2, v_1_0, v_1_1 = _i2+1, v_1_1, v_1_0 {
|
||||
if x != v_1_0 || v_1_1.Op != OpConst8 {
|
||||
continue
|
||||
}
|
||||
d := auxIntToInt8(v_1_1.AuxInt)
|
||||
if !(c|d == c && oneBit(c^d)) {
|
||||
continue
|
||||
}
|
||||
v.reset(OpNeq8)
|
||||
v0 := b.NewValue0(v.Pos, OpOr8, x.Type)
|
||||
v1 := b.NewValue0(v.Pos, OpConst8, x.Type)
|
||||
v1.AuxInt = int8ToAuxInt(c ^ d)
|
||||
v0.AddArg2(x, v1)
|
||||
v.AddArg2(v0, cv)
|
||||
return true
|
||||
}
|
||||
}
|
||||
}
|
||||
break
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValuegeneric_OpArraySelect(v *Value) bool {
|
||||
|
|
@ -8809,16 +8985,13 @@ func rewriteValuegeneric_OpFloor(v *Value) bool {
|
|||
func rewriteValuegeneric_OpIMake(v *Value) bool {
|
||||
v_1 := v.Args[1]
|
||||
v_0 := v.Args[0]
|
||||
// match: (IMake _typ (StructMake val))
|
||||
// result: (IMake _typ val)
|
||||
// match: (IMake _typ (StructMake ___))
|
||||
// result: imakeOfStructMake(v)
|
||||
for {
|
||||
_typ := v_0
|
||||
if v_1.Op != OpStructMake || len(v_1.Args) != 1 {
|
||||
if v_1.Op != OpStructMake {
|
||||
break
|
||||
}
|
||||
val := v_1.Args[0]
|
||||
v.reset(OpIMake)
|
||||
v.AddArg2(_typ, val)
|
||||
v.copyOf(imakeOfStructMake(v))
|
||||
return true
|
||||
}
|
||||
// match: (IMake _typ (ArrayMake1 val))
|
||||
|
|
@ -16610,6 +16783,45 @@ func rewriteValuegeneric_OpMul16(v *Value) bool {
|
|||
}
|
||||
break
|
||||
}
|
||||
// match: (Mul16 (Const16 <t> [c]) (Neg16 x))
|
||||
// result: (Mul16 x (Const16 <t> [-c]))
|
||||
for {
|
||||
for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
|
||||
if v_0.Op != OpConst16 {
|
||||
continue
|
||||
}
|
||||
t := v_0.Type
|
||||
c := auxIntToInt16(v_0.AuxInt)
|
||||
if v_1.Op != OpNeg16 {
|
||||
continue
|
||||
}
|
||||
x := v_1.Args[0]
|
||||
v.reset(OpMul16)
|
||||
v0 := b.NewValue0(v.Pos, OpConst16, t)
|
||||
v0.AuxInt = int16ToAuxInt(-c)
|
||||
v.AddArg2(x, v0)
|
||||
return true
|
||||
}
|
||||
break
|
||||
}
|
||||
// match: (Mul16 (Neg16 x) (Neg16 y))
|
||||
// result: (Mul16 x y)
|
||||
for {
|
||||
for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
|
||||
if v_0.Op != OpNeg16 {
|
||||
continue
|
||||
}
|
||||
x := v_0.Args[0]
|
||||
if v_1.Op != OpNeg16 {
|
||||
continue
|
||||
}
|
||||
y := v_1.Args[0]
|
||||
v.reset(OpMul16)
|
||||
v.AddArg2(x, y)
|
||||
return true
|
||||
}
|
||||
break
|
||||
}
|
||||
// match: (Mul16 (Const16 <t> [c]) (Add16 <t> (Const16 <t> [d]) x))
|
||||
// cond: !isPowerOfTwo(c)
|
||||
// result: (Add16 (Const16 <t> [c*d]) (Mul16 <t> (Const16 <t> [c]) x))
|
||||
|
|
@ -16821,6 +17033,45 @@ func rewriteValuegeneric_OpMul32(v *Value) bool {
|
|||
}
|
||||
break
|
||||
}
|
||||
// match: (Mul32 (Const32 <t> [c]) (Neg32 x))
|
||||
// result: (Mul32 x (Const32 <t> [-c]))
|
||||
for {
|
||||
for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
|
||||
if v_0.Op != OpConst32 {
|
||||
continue
|
||||
}
|
||||
t := v_0.Type
|
||||
c := auxIntToInt32(v_0.AuxInt)
|
||||
if v_1.Op != OpNeg32 {
|
||||
continue
|
||||
}
|
||||
x := v_1.Args[0]
|
||||
v.reset(OpMul32)
|
||||
v0 := b.NewValue0(v.Pos, OpConst32, t)
|
||||
v0.AuxInt = int32ToAuxInt(-c)
|
||||
v.AddArg2(x, v0)
|
||||
return true
|
||||
}
|
||||
break
|
||||
}
|
||||
// match: (Mul32 (Neg32 x) (Neg32 y))
|
||||
// result: (Mul32 x y)
|
||||
for {
|
||||
for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
|
||||
if v_0.Op != OpNeg32 {
|
||||
continue
|
||||
}
|
||||
x := v_0.Args[0]
|
||||
if v_1.Op != OpNeg32 {
|
||||
continue
|
||||
}
|
||||
y := v_1.Args[0]
|
||||
v.reset(OpMul32)
|
||||
v.AddArg2(x, y)
|
||||
return true
|
||||
}
|
||||
break
|
||||
}
|
||||
// match: (Mul32 (Const32 <t> [c]) (Add32 <t> (Const32 <t> [d]) x))
|
||||
// cond: !isPowerOfTwo(c)
|
||||
// result: (Add32 (Const32 <t> [c*d]) (Mul32 <t> (Const32 <t> [c]) x))
|
||||
|
|
@ -17193,6 +17444,45 @@ func rewriteValuegeneric_OpMul64(v *Value) bool {
|
|||
}
|
||||
break
|
||||
}
|
||||
// match: (Mul64 (Const64 <t> [c]) (Neg64 x))
|
||||
// result: (Mul64 x (Const64 <t> [-c]))
|
||||
for {
|
||||
for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
|
||||
if v_0.Op != OpConst64 {
|
||||
continue
|
||||
}
|
||||
t := v_0.Type
|
||||
c := auxIntToInt64(v_0.AuxInt)
|
||||
if v_1.Op != OpNeg64 {
|
||||
continue
|
||||
}
|
||||
x := v_1.Args[0]
|
||||
v.reset(OpMul64)
|
||||
v0 := b.NewValue0(v.Pos, OpConst64, t)
|
||||
v0.AuxInt = int64ToAuxInt(-c)
|
||||
v.AddArg2(x, v0)
|
||||
return true
|
||||
}
|
||||
break
|
||||
}
|
||||
// match: (Mul64 (Neg64 x) (Neg64 y))
|
||||
// result: (Mul64 x y)
|
||||
for {
|
||||
for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
|
||||
if v_0.Op != OpNeg64 {
|
||||
continue
|
||||
}
|
||||
x := v_0.Args[0]
|
||||
if v_1.Op != OpNeg64 {
|
||||
continue
|
||||
}
|
||||
y := v_1.Args[0]
|
||||
v.reset(OpMul64)
|
||||
v.AddArg2(x, y)
|
||||
return true
|
||||
}
|
||||
break
|
||||
}
|
||||
// match: (Mul64 (Const64 <t> [c]) (Add64 <t> (Const64 <t> [d]) x))
|
||||
// cond: !isPowerOfTwo(c)
|
||||
// result: (Add64 (Const64 <t> [c*d]) (Mul64 <t> (Const64 <t> [c]) x))
|
||||
|
|
@ -17565,6 +17855,45 @@ func rewriteValuegeneric_OpMul8(v *Value) bool {
|
|||
}
|
||||
break
|
||||
}
|
||||
// match: (Mul8 (Const8 <t> [c]) (Neg8 x))
|
||||
// result: (Mul8 x (Const8 <t> [-c]))
|
||||
for {
|
||||
for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
|
||||
if v_0.Op != OpConst8 {
|
||||
continue
|
||||
}
|
||||
t := v_0.Type
|
||||
c := auxIntToInt8(v_0.AuxInt)
|
||||
if v_1.Op != OpNeg8 {
|
||||
continue
|
||||
}
|
||||
x := v_1.Args[0]
|
||||
v.reset(OpMul8)
|
||||
v0 := b.NewValue0(v.Pos, OpConst8, t)
|
||||
v0.AuxInt = int8ToAuxInt(-c)
|
||||
v.AddArg2(x, v0)
|
||||
return true
|
||||
}
|
||||
break
|
||||
}
|
||||
// match: (Mul8 (Neg8 x) (Neg8 y))
|
||||
// result: (Mul8 x y)
|
||||
for {
|
||||
for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
|
||||
if v_0.Op != OpNeg8 {
|
||||
continue
|
||||
}
|
||||
x := v_0.Args[0]
|
||||
if v_1.Op != OpNeg8 {
|
||||
continue
|
||||
}
|
||||
y := v_1.Args[0]
|
||||
v.reset(OpMul8)
|
||||
v.AddArg2(x, y)
|
||||
return true
|
||||
}
|
||||
break
|
||||
}
|
||||
// match: (Mul8 (Const8 <t> [c]) (Add8 <t> (Const8 <t> [d]) x))
|
||||
// cond: !isPowerOfTwo(c)
|
||||
// result: (Add8 (Const8 <t> [c*d]) (Mul8 <t> (Const8 <t> [c]) x))
|
||||
|
|
@ -23242,6 +23571,182 @@ func rewriteValuegeneric_OpOrB(v *Value) bool {
|
|||
}
|
||||
break
|
||||
}
|
||||
// match: (OrB (Eq64 x cv:(Const64 [c])) (Eq64 x (Const64 [d])))
|
||||
// cond: c|d == c && oneBit(c^d)
|
||||
// result: (Eq64 (Or64 <x.Type> x (Const64 <x.Type> [c^d])) cv)
|
||||
for {
|
||||
for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
|
||||
if v_0.Op != OpEq64 {
|
||||
continue
|
||||
}
|
||||
_ = v_0.Args[1]
|
||||
v_0_0 := v_0.Args[0]
|
||||
v_0_1 := v_0.Args[1]
|
||||
for _i1 := 0; _i1 <= 1; _i1, v_0_0, v_0_1 = _i1+1, v_0_1, v_0_0 {
|
||||
x := v_0_0
|
||||
cv := v_0_1
|
||||
if cv.Op != OpConst64 {
|
||||
continue
|
||||
}
|
||||
c := auxIntToInt64(cv.AuxInt)
|
||||
if v_1.Op != OpEq64 {
|
||||
continue
|
||||
}
|
||||
_ = v_1.Args[1]
|
||||
v_1_0 := v_1.Args[0]
|
||||
v_1_1 := v_1.Args[1]
|
||||
for _i2 := 0; _i2 <= 1; _i2, v_1_0, v_1_1 = _i2+1, v_1_1, v_1_0 {
|
||||
if x != v_1_0 || v_1_1.Op != OpConst64 {
|
||||
continue
|
||||
}
|
||||
d := auxIntToInt64(v_1_1.AuxInt)
|
||||
if !(c|d == c && oneBit(c^d)) {
|
||||
continue
|
||||
}
|
||||
v.reset(OpEq64)
|
||||
v0 := b.NewValue0(v.Pos, OpOr64, x.Type)
|
||||
v1 := b.NewValue0(v.Pos, OpConst64, x.Type)
|
||||
v1.AuxInt = int64ToAuxInt(c ^ d)
|
||||
v0.AddArg2(x, v1)
|
||||
v.AddArg2(v0, cv)
|
||||
return true
|
||||
}
|
||||
}
|
||||
}
|
||||
break
|
||||
}
|
||||
// match: (OrB (Eq32 x cv:(Const32 [c])) (Eq32 x (Const32 [d])))
|
||||
// cond: c|d == c && oneBit(c^d)
|
||||
// result: (Eq32 (Or32 <x.Type> x (Const32 <x.Type> [c^d])) cv)
|
||||
for {
|
||||
for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
|
||||
if v_0.Op != OpEq32 {
|
||||
continue
|
||||
}
|
||||
_ = v_0.Args[1]
|
||||
v_0_0 := v_0.Args[0]
|
||||
v_0_1 := v_0.Args[1]
|
||||
for _i1 := 0; _i1 <= 1; _i1, v_0_0, v_0_1 = _i1+1, v_0_1, v_0_0 {
|
||||
x := v_0_0
|
||||
cv := v_0_1
|
||||
if cv.Op != OpConst32 {
|
||||
continue
|
||||
}
|
||||
c := auxIntToInt32(cv.AuxInt)
|
||||
if v_1.Op != OpEq32 {
|
||||
continue
|
||||
}
|
||||
_ = v_1.Args[1]
|
||||
v_1_0 := v_1.Args[0]
|
||||
v_1_1 := v_1.Args[1]
|
||||
for _i2 := 0; _i2 <= 1; _i2, v_1_0, v_1_1 = _i2+1, v_1_1, v_1_0 {
|
||||
if x != v_1_0 || v_1_1.Op != OpConst32 {
|
||||
continue
|
||||
}
|
||||
d := auxIntToInt32(v_1_1.AuxInt)
|
||||
if !(c|d == c && oneBit(c^d)) {
|
||||
continue
|
||||
}
|
||||
v.reset(OpEq32)
|
||||
v0 := b.NewValue0(v.Pos, OpOr32, x.Type)
|
||||
v1 := b.NewValue0(v.Pos, OpConst32, x.Type)
|
||||
v1.AuxInt = int32ToAuxInt(c ^ d)
|
||||
v0.AddArg2(x, v1)
|
||||
v.AddArg2(v0, cv)
|
||||
return true
|
||||
}
|
||||
}
|
||||
}
|
||||
break
|
||||
}
|
||||
// match: (OrB (Eq16 x cv:(Const16 [c])) (Eq16 x (Const16 [d])))
|
||||
// cond: c|d == c && oneBit(c^d)
|
||||
// result: (Eq16 (Or16 <x.Type> x (Const16 <x.Type> [c^d])) cv)
|
||||
for {
|
||||
for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
|
||||
if v_0.Op != OpEq16 {
|
||||
continue
|
||||
}
|
||||
_ = v_0.Args[1]
|
||||
v_0_0 := v_0.Args[0]
|
||||
v_0_1 := v_0.Args[1]
|
||||
for _i1 := 0; _i1 <= 1; _i1, v_0_0, v_0_1 = _i1+1, v_0_1, v_0_0 {
|
||||
x := v_0_0
|
||||
cv := v_0_1
|
||||
if cv.Op != OpConst16 {
|
||||
continue
|
||||
}
|
||||
c := auxIntToInt16(cv.AuxInt)
|
||||
if v_1.Op != OpEq16 {
|
||||
continue
|
||||
}
|
||||
_ = v_1.Args[1]
|
||||
v_1_0 := v_1.Args[0]
|
||||
v_1_1 := v_1.Args[1]
|
||||
for _i2 := 0; _i2 <= 1; _i2, v_1_0, v_1_1 = _i2+1, v_1_1, v_1_0 {
|
||||
if x != v_1_0 || v_1_1.Op != OpConst16 {
|
||||
continue
|
||||
}
|
||||
d := auxIntToInt16(v_1_1.AuxInt)
|
||||
if !(c|d == c && oneBit(c^d)) {
|
||||
continue
|
||||
}
|
||||
v.reset(OpEq16)
|
||||
v0 := b.NewValue0(v.Pos, OpOr16, x.Type)
|
||||
v1 := b.NewValue0(v.Pos, OpConst16, x.Type)
|
||||
v1.AuxInt = int16ToAuxInt(c ^ d)
|
||||
v0.AddArg2(x, v1)
|
||||
v.AddArg2(v0, cv)
|
||||
return true
|
||||
}
|
||||
}
|
||||
}
|
||||
break
|
||||
}
|
||||
// match: (OrB (Eq8 x cv:(Const8 [c])) (Eq8 x (Const8 [d])))
|
||||
// cond: c|d == c && oneBit(c^d)
|
||||
// result: (Eq8 (Or8 <x.Type> x (Const8 <x.Type> [c^d])) cv)
|
||||
for {
|
||||
for _i0 := 0; _i0 <= 1; _i0, v_0, v_1 = _i0+1, v_1, v_0 {
|
||||
if v_0.Op != OpEq8 {
|
||||
continue
|
||||
}
|
||||
_ = v_0.Args[1]
|
||||
v_0_0 := v_0.Args[0]
|
||||
v_0_1 := v_0.Args[1]
|
||||
for _i1 := 0; _i1 <= 1; _i1, v_0_0, v_0_1 = _i1+1, v_0_1, v_0_0 {
|
||||
x := v_0_0
|
||||
cv := v_0_1
|
||||
if cv.Op != OpConst8 {
|
||||
continue
|
||||
}
|
||||
c := auxIntToInt8(cv.AuxInt)
|
||||
if v_1.Op != OpEq8 {
|
||||
continue
|
||||
}
|
||||
_ = v_1.Args[1]
|
||||
v_1_0 := v_1.Args[0]
|
||||
v_1_1 := v_1.Args[1]
|
||||
for _i2 := 0; _i2 <= 1; _i2, v_1_0, v_1_1 = _i2+1, v_1_1, v_1_0 {
|
||||
if x != v_1_0 || v_1_1.Op != OpConst8 {
|
||||
continue
|
||||
}
|
||||
d := auxIntToInt8(v_1_1.AuxInt)
|
||||
if !(c|d == c && oneBit(c^d)) {
|
||||
continue
|
||||
}
|
||||
v.reset(OpEq8)
|
||||
v0 := b.NewValue0(v.Pos, OpOr8, x.Type)
|
||||
v1 := b.NewValue0(v.Pos, OpConst8, x.Type)
|
||||
v1.AuxInt = int8ToAuxInt(c ^ d)
|
||||
v0.AddArg2(x, v1)
|
||||
v.AddArg2(v0, cv)
|
||||
return true
|
||||
}
|
||||
}
|
||||
}
|
||||
break
|
||||
}
|
||||
// match: (OrB (Neq64F x x) (Less64F x y:(Const64F [c])))
|
||||
// result: (Not (Leq64F y x))
|
||||
for {
|
||||
|
|
@ -31601,17 +32106,47 @@ func rewriteValuegeneric_OpStructSelect(v *Value) bool {
|
|||
v0.AddArg2(v1, mem)
|
||||
return true
|
||||
}
|
||||
// match: (StructSelect [0] (IData x))
|
||||
// match: (StructSelect (IData x))
|
||||
// cond: v.Type.Size() > 0
|
||||
// result: (IData x)
|
||||
for {
|
||||
if auxIntToInt64(v.AuxInt) != 0 || v_0.Op != OpIData {
|
||||
if v_0.Op != OpIData {
|
||||
break
|
||||
}
|
||||
x := v_0.Args[0]
|
||||
if !(v.Type.Size() > 0) {
|
||||
break
|
||||
}
|
||||
v.reset(OpIData)
|
||||
v.AddArg(x)
|
||||
return true
|
||||
}
|
||||
// match: (StructSelect (IData x))
|
||||
// cond: v.Type.Size() == 0 && v.Type.IsStruct()
|
||||
// result: (StructMake)
|
||||
for {
|
||||
if v_0.Op != OpIData {
|
||||
break
|
||||
}
|
||||
if !(v.Type.Size() == 0 && v.Type.IsStruct()) {
|
||||
break
|
||||
}
|
||||
v.reset(OpStructMake)
|
||||
return true
|
||||
}
|
||||
// match: (StructSelect (IData x))
|
||||
// cond: v.Type.Size() == 0 && v.Type.IsArray()
|
||||
// result: (ArrayMake0)
|
||||
for {
|
||||
if v_0.Op != OpIData {
|
||||
break
|
||||
}
|
||||
if !(v.Type.Size() == 0 && v.Type.IsArray()) {
|
||||
break
|
||||
}
|
||||
v.reset(OpArrayMake0)
|
||||
return true
|
||||
}
|
||||
return false
|
||||
}
|
||||
func rewriteValuegeneric_OpSub16(v *Value) bool {
|
||||
|
|
|
|||
|
|
@ -124,6 +124,11 @@ func InitConfig() {
|
|||
ir.Syms.GCWriteBarrier[7] = typecheck.LookupRuntimeFunc("gcWriteBarrier8")
|
||||
ir.Syms.Goschedguarded = typecheck.LookupRuntimeFunc("goschedguarded")
|
||||
ir.Syms.Growslice = typecheck.LookupRuntimeFunc("growslice")
|
||||
ir.Syms.GrowsliceBuf = typecheck.LookupRuntimeFunc("growsliceBuf")
|
||||
ir.Syms.MoveSlice = typecheck.LookupRuntimeFunc("moveSlice")
|
||||
ir.Syms.MoveSliceNoScan = typecheck.LookupRuntimeFunc("moveSliceNoScan")
|
||||
ir.Syms.MoveSliceNoCap = typecheck.LookupRuntimeFunc("moveSliceNoCap")
|
||||
ir.Syms.MoveSliceNoCapNoScan = typecheck.LookupRuntimeFunc("moveSliceNoCapNoScan")
|
||||
ir.Syms.InterfaceSwitch = typecheck.LookupRuntimeFunc("interfaceSwitch")
|
||||
for i := 1; i < len(ir.Syms.MallocGCSmallNoScan); i++ {
|
||||
ir.Syms.MallocGCSmallNoScan[i] = typecheck.LookupRuntimeFunc(fmt.Sprintf("mallocgcSmallNoScanSC%d", i))
|
||||
|
|
@ -1096,6 +1101,23 @@ type state struct {
|
|||
|
||||
// Block starting position, indexed by block id.
|
||||
blockStarts []src.XPos
|
||||
|
||||
// Information for stack allocation. Indexed by the first argument
|
||||
// to an append call. Normally a slice-typed variable, but not always.
|
||||
backingStores map[ir.Node]*backingStoreInfo
|
||||
}
|
||||
|
||||
type backingStoreInfo struct {
|
||||
// Size of backing store array (in elements)
|
||||
K int64
|
||||
// Stack-allocated backing store variable.
|
||||
store *ir.Name
|
||||
// Dynamic boolean variable marking the fact that we used this backing store.
|
||||
used *ir.Name
|
||||
// Have we used this variable statically yet? This is just a hint
|
||||
// to avoid checking the dynamic variable if the answer is obvious.
|
||||
// (usedStatic == true implies used == true)
|
||||
usedStatic bool
|
||||
}
|
||||
|
||||
type funcLine struct {
|
||||
|
|
@ -3683,6 +3705,9 @@ func (s *state) exprCheckPtr(n ir.Node, checkPtrOK bool) *ssa.Value {
|
|||
case ir.OAPPEND:
|
||||
return s.append(n.(*ir.CallExpr), false)
|
||||
|
||||
case ir.OMOVE2HEAP:
|
||||
return s.move2heap(n.(*ir.MoveToHeapExpr))
|
||||
|
||||
case ir.OMIN, ir.OMAX:
|
||||
return s.minMax(n.(*ir.CallExpr))
|
||||
|
||||
|
|
@ -3744,6 +3769,68 @@ func (s *state) resultAddrOfCall(c *ssa.Value, which int64, t *types.Type) *ssa.
|
|||
return addr
|
||||
}
|
||||
|
||||
// Get backing store information for an append call.
|
||||
func (s *state) getBackingStoreInfoForAppend(n *ir.CallExpr) *backingStoreInfo {
|
||||
if n.Esc() != ir.EscNone {
|
||||
return nil
|
||||
}
|
||||
return s.getBackingStoreInfo(n.Args[0])
|
||||
}
|
||||
func (s *state) getBackingStoreInfo(n ir.Node) *backingStoreInfo {
|
||||
t := n.Type()
|
||||
et := t.Elem()
|
||||
maxStackSize := int64(base.Debug.VariableMakeThreshold)
|
||||
if et.Size() == 0 || et.Size() > maxStackSize {
|
||||
return nil
|
||||
}
|
||||
if base.Flag.N != 0 {
|
||||
return nil
|
||||
}
|
||||
if !base.VariableMakeHash.MatchPos(n.Pos(), nil) {
|
||||
return nil
|
||||
}
|
||||
i := s.backingStores[n]
|
||||
if i != nil {
|
||||
return i
|
||||
}
|
||||
|
||||
// Build type of backing store.
|
||||
K := maxStackSize / et.Size() // rounds down
|
||||
KT := types.NewArray(et, K)
|
||||
KT.SetNoalg(true)
|
||||
types.CalcArraySize(KT)
|
||||
// Align more than naturally for the type KT. See issue 73199.
|
||||
align := types.NewArray(types.Types[types.TUINTPTR], 0)
|
||||
types.CalcArraySize(align)
|
||||
storeTyp := types.NewStruct([]*types.Field{
|
||||
{Sym: types.BlankSym, Type: align},
|
||||
{Sym: types.BlankSym, Type: KT},
|
||||
})
|
||||
storeTyp.SetNoalg(true)
|
||||
types.CalcStructSize(storeTyp)
|
||||
|
||||
// Make backing store variable.
|
||||
backingStore := typecheck.TempAt(n.Pos(), s.curfn, storeTyp)
|
||||
backingStore.SetAddrtaken(true)
|
||||
|
||||
// Make "used" boolean.
|
||||
used := typecheck.TempAt(n.Pos(), s.curfn, types.Types[types.TBOOL])
|
||||
if s.curBlock == s.f.Entry {
|
||||
s.vars[used] = s.constBool(false)
|
||||
} else {
|
||||
// initialize this variable at end of entry block
|
||||
s.defvars[s.f.Entry.ID][used] = s.constBool(false)
|
||||
}
|
||||
|
||||
// Initialize an info structure.
|
||||
if s.backingStores == nil {
|
||||
s.backingStores = map[ir.Node]*backingStoreInfo{}
|
||||
}
|
||||
i = &backingStoreInfo{K: K, store: backingStore, used: used, usedStatic: false}
|
||||
s.backingStores[n] = i
|
||||
return i
|
||||
}
|
||||
|
||||
// append converts an OAPPEND node to SSA.
|
||||
// If inplace is false, it converts the OAPPEND expression n to an ssa.Value,
|
||||
// adds it to s, and returns the Value.
|
||||
|
|
@ -3834,9 +3921,29 @@ func (s *state) append(n *ir.CallExpr, inplace bool) *ssa.Value {
|
|||
// A stack-allocated backing store could be used at every
|
||||
// append that qualifies, but we limit it in some cases to
|
||||
// avoid wasted code and stack space.
|
||||
// TODO: handle ... append case.
|
||||
maxStackSize := int64(base.Debug.VariableMakeThreshold)
|
||||
if !inplace && n.Esc() == ir.EscNone && et.Size() > 0 && et.Size() <= maxStackSize && base.Flag.N == 0 && base.VariableMakeHash.MatchPos(n.Pos(), nil) && !s.appendTargets[sn] {
|
||||
//
|
||||
// Note that we have two different strategies.
|
||||
// 1. The standard strategy is just to allocate the full
|
||||
// backing store at the first append.
|
||||
// 2. An alternate strategy is used when
|
||||
// a. The backing store eventually escapes via move2heap
|
||||
// and b. The capacity is used somehow
|
||||
// In this case, we don't want to just allocate
|
||||
// the full buffer at the first append, because when
|
||||
// we move2heap the buffer to the heap when it escapes,
|
||||
// we might end up wasting memory because we can't
|
||||
// change the capacity.
|
||||
// So in this case we use growsliceBuf to reuse the buffer
|
||||
// and walk one step up the size class ladder each time.
|
||||
//
|
||||
// TODO: handle ... append case? Currently we handle only
|
||||
// a fixed number of appended elements.
|
||||
var info *backingStoreInfo
|
||||
if !inplace {
|
||||
info = s.getBackingStoreInfoForAppend(n)
|
||||
}
|
||||
|
||||
if !inplace && info != nil && !n.UseBuf && !info.usedStatic {
|
||||
// if l <= K {
|
||||
// if !used {
|
||||
// if oldLen == 0 {
|
||||
|
|
@ -3860,43 +3967,19 @@ func (s *state) append(n *ir.CallExpr, inplace bool) *ssa.Value {
|
|||
// It is ok to do it more often, but it is probably helpful only for
|
||||
// the first instance. TODO: this could use more tuning. Using ir.Node
|
||||
// as the key works for *ir.Name instances but probably nothing else.
|
||||
if s.appendTargets == nil {
|
||||
s.appendTargets = map[ir.Node]bool{}
|
||||
}
|
||||
s.appendTargets[sn] = true
|
||||
|
||||
K := maxStackSize / et.Size() // rounds down
|
||||
KT := types.NewArray(et, K)
|
||||
KT.SetNoalg(true)
|
||||
types.CalcArraySize(KT)
|
||||
// Align more than naturally for the type KT. See issue 73199.
|
||||
align := types.NewArray(types.Types[types.TUINTPTR], 0)
|
||||
types.CalcArraySize(align)
|
||||
storeTyp := types.NewStruct([]*types.Field{
|
||||
{Sym: types.BlankSym, Type: align},
|
||||
{Sym: types.BlankSym, Type: KT},
|
||||
})
|
||||
storeTyp.SetNoalg(true)
|
||||
types.CalcStructSize(storeTyp)
|
||||
info.usedStatic = true
|
||||
// TODO: unset usedStatic somehow?
|
||||
|
||||
usedTestBlock := s.f.NewBlock(ssa.BlockPlain)
|
||||
oldLenTestBlock := s.f.NewBlock(ssa.BlockPlain)
|
||||
bodyBlock := s.f.NewBlock(ssa.BlockPlain)
|
||||
growSlice := s.f.NewBlock(ssa.BlockPlain)
|
||||
|
||||
// Make "used" boolean.
|
||||
tBool := types.Types[types.TBOOL]
|
||||
used := typecheck.TempAt(n.Pos(), s.curfn, tBool)
|
||||
s.defvars[s.f.Entry.ID][used] = s.constBool(false) // initialize this variable at fn entry
|
||||
|
||||
// Make backing store variable.
|
||||
tInt := types.Types[types.TINT]
|
||||
backingStore := typecheck.TempAt(n.Pos(), s.curfn, storeTyp)
|
||||
backingStore.SetAddrtaken(true)
|
||||
tBool := types.Types[types.TBOOL]
|
||||
|
||||
// if l <= K
|
||||
s.startBlock(grow)
|
||||
kTest := s.newValue2(s.ssaOp(ir.OLE, tInt), tBool, l, s.constInt(tInt, K))
|
||||
kTest := s.newValue2(s.ssaOp(ir.OLE, tInt), tBool, l, s.constInt(tInt, info.K))
|
||||
b := s.endBlock()
|
||||
b.Kind = ssa.BlockIf
|
||||
b.SetControl(kTest)
|
||||
|
|
@ -3906,7 +3989,7 @@ func (s *state) append(n *ir.CallExpr, inplace bool) *ssa.Value {
|
|||
|
||||
// if !used
|
||||
s.startBlock(usedTestBlock)
|
||||
usedTest := s.newValue1(ssa.OpNot, tBool, s.expr(used))
|
||||
usedTest := s.newValue1(ssa.OpNot, tBool, s.expr(info.used))
|
||||
b = s.endBlock()
|
||||
b.Kind = ssa.BlockIf
|
||||
b.SetControl(usedTest)
|
||||
|
|
@ -3927,18 +4010,18 @@ func (s *state) append(n *ir.CallExpr, inplace bool) *ssa.Value {
|
|||
// var store struct { _ [0]uintptr; arr [K]T }
|
||||
s.startBlock(bodyBlock)
|
||||
if et.HasPointers() {
|
||||
s.vars[memVar] = s.newValue1A(ssa.OpVarDef, types.TypeMem, backingStore, s.mem())
|
||||
s.vars[memVar] = s.newValue1A(ssa.OpVarDef, types.TypeMem, info.store, s.mem())
|
||||
}
|
||||
addr := s.addr(backingStore)
|
||||
s.zero(storeTyp, addr)
|
||||
addr := s.addr(info.store)
|
||||
s.zero(info.store.Type(), addr)
|
||||
|
||||
// s = store.arr[:l:K]
|
||||
s.vars[ptrVar] = addr
|
||||
s.vars[lenVar] = l // nargs would also be ok because of the oldLen==0 test.
|
||||
s.vars[capVar] = s.constInt(tInt, K)
|
||||
s.vars[capVar] = s.constInt(tInt, info.K)
|
||||
|
||||
// used = true
|
||||
s.assign(used, s.constBool(true), false, 0)
|
||||
s.assign(info.used, s.constBool(true), false, 0)
|
||||
b = s.endBlock()
|
||||
b.AddEdgeTo(assign)
|
||||
|
||||
|
|
@ -3949,7 +4032,25 @@ func (s *state) append(n *ir.CallExpr, inplace bool) *ssa.Value {
|
|||
// Call growslice
|
||||
s.startBlock(grow)
|
||||
taddr := s.expr(n.Fun)
|
||||
r := s.rtcall(ir.Syms.Growslice, true, []*types.Type{n.Type()}, p, l, c, nargs, taddr)
|
||||
var r []*ssa.Value
|
||||
if info != nil && n.UseBuf {
|
||||
// Use stack-allocated buffer as backing store, if we can.
|
||||
if et.HasPointers() && !info.usedStatic {
|
||||
// Initialize in the function header. Not the best place,
|
||||
// but it makes sure we don't scan this area before it is
|
||||
// initialized.
|
||||
mem := s.defvars[s.f.Entry.ID][memVar]
|
||||
mem = s.f.Entry.NewValue1A(n.Pos(), ssa.OpVarDef, types.TypeMem, info.store, mem)
|
||||
addr := s.f.Entry.NewValue2A(n.Pos(), ssa.OpLocalAddr, types.NewPtr(info.store.Type()), info.store, s.sp, mem)
|
||||
mem = s.f.Entry.NewValue2I(n.Pos(), ssa.OpZero, types.TypeMem, info.store.Type().Size(), addr, mem)
|
||||
mem.Aux = info.store.Type()
|
||||
s.defvars[s.f.Entry.ID][memVar] = mem
|
||||
info.usedStatic = true
|
||||
}
|
||||
r = s.rtcall(ir.Syms.GrowsliceBuf, true, []*types.Type{n.Type()}, p, l, c, nargs, taddr, s.addr(info.store), s.constInt(types.Types[types.TINT], info.K))
|
||||
} else {
|
||||
r = s.rtcall(ir.Syms.Growslice, true, []*types.Type{n.Type()}, p, l, c, nargs, taddr)
|
||||
}
|
||||
|
||||
// Decompose output slice
|
||||
p = s.newValue1(ssa.OpSlicePtr, pt, r[0])
|
||||
|
|
@ -4036,6 +4137,95 @@ func (s *state) append(n *ir.CallExpr, inplace bool) *ssa.Value {
|
|||
return s.newValue3(ssa.OpSliceMake, n.Type(), p, l, c)
|
||||
}
|
||||
|
||||
func (s *state) move2heap(n *ir.MoveToHeapExpr) *ssa.Value {
|
||||
// s := n.Slice
|
||||
// if s.ptr points to current stack frame {
|
||||
// s2 := make([]T, s.len, s.cap)
|
||||
// copy(s2[:cap], s[:cap])
|
||||
// s = s2
|
||||
// }
|
||||
// return s
|
||||
|
||||
slice := s.expr(n.Slice)
|
||||
et := slice.Type.Elem()
|
||||
pt := types.NewPtr(et)
|
||||
|
||||
info := s.getBackingStoreInfo(n)
|
||||
if info == nil {
|
||||
// Backing store will never be stack allocated, so
|
||||
// move2heap is a no-op.
|
||||
return slice
|
||||
}
|
||||
|
||||
// Decomposse input slice.
|
||||
p := s.newValue1(ssa.OpSlicePtr, pt, slice)
|
||||
l := s.newValue1(ssa.OpSliceLen, types.Types[types.TINT], slice)
|
||||
c := s.newValue1(ssa.OpSliceCap, types.Types[types.TINT], slice)
|
||||
|
||||
moveBlock := s.f.NewBlock(ssa.BlockPlain)
|
||||
mergeBlock := s.f.NewBlock(ssa.BlockPlain)
|
||||
|
||||
s.vars[ptrVar] = p
|
||||
s.vars[lenVar] = l
|
||||
s.vars[capVar] = c
|
||||
|
||||
// Decide if we need to move the slice backing store.
|
||||
// It needs to be moved if it is currently on the stack.
|
||||
sub := ssa.OpSub64
|
||||
less := ssa.OpLess64U
|
||||
if s.config.PtrSize == 4 {
|
||||
sub = ssa.OpSub32
|
||||
less = ssa.OpLess32U
|
||||
}
|
||||
callerSP := s.newValue1(ssa.OpGetCallerSP, types.Types[types.TUINTPTR], s.mem())
|
||||
frameSize := s.newValue2(sub, types.Types[types.TUINTPTR], callerSP, s.sp)
|
||||
pInt := s.newValue2(ssa.OpConvert, types.Types[types.TUINTPTR], p, s.mem())
|
||||
off := s.newValue2(sub, types.Types[types.TUINTPTR], pInt, s.sp)
|
||||
cond := s.newValue2(less, types.Types[types.TBOOL], off, frameSize)
|
||||
|
||||
b := s.endBlock()
|
||||
b.Kind = ssa.BlockIf
|
||||
b.Likely = ssa.BranchUnlikely // fast path is to not have to call into runtime
|
||||
b.SetControl(cond)
|
||||
b.AddEdgeTo(moveBlock)
|
||||
b.AddEdgeTo(mergeBlock)
|
||||
|
||||
// Move the slice to heap
|
||||
s.startBlock(moveBlock)
|
||||
var newSlice *ssa.Value
|
||||
if et.HasPointers() {
|
||||
typ := s.expr(n.RType)
|
||||
if n.PreserveCapacity {
|
||||
newSlice = s.rtcall(ir.Syms.MoveSlice, true, []*types.Type{slice.Type}, typ, p, l, c)[0]
|
||||
} else {
|
||||
newSlice = s.rtcall(ir.Syms.MoveSliceNoCap, true, []*types.Type{slice.Type}, typ, p, l)[0]
|
||||
}
|
||||
} else {
|
||||
elemSize := s.constInt(types.Types[types.TUINTPTR], et.Size())
|
||||
if n.PreserveCapacity {
|
||||
newSlice = s.rtcall(ir.Syms.MoveSliceNoScan, true, []*types.Type{slice.Type}, elemSize, p, l, c)[0]
|
||||
} else {
|
||||
newSlice = s.rtcall(ir.Syms.MoveSliceNoCapNoScan, true, []*types.Type{slice.Type}, elemSize, p, l)[0]
|
||||
}
|
||||
}
|
||||
// Decompose output slice
|
||||
s.vars[ptrVar] = s.newValue1(ssa.OpSlicePtr, pt, newSlice)
|
||||
s.vars[lenVar] = s.newValue1(ssa.OpSliceLen, types.Types[types.TINT], newSlice)
|
||||
s.vars[capVar] = s.newValue1(ssa.OpSliceCap, types.Types[types.TINT], newSlice)
|
||||
b = s.endBlock()
|
||||
b.AddEdgeTo(mergeBlock)
|
||||
|
||||
// Merge fast path (no moving) and slow path (moved)
|
||||
s.startBlock(mergeBlock)
|
||||
p = s.variable(ptrVar, pt) // generates phi for ptr
|
||||
l = s.variable(lenVar, types.Types[types.TINT]) // generates phi for len
|
||||
c = s.variable(capVar, types.Types[types.TINT]) // generates phi for cap
|
||||
delete(s.vars, ptrVar)
|
||||
delete(s.vars, lenVar)
|
||||
delete(s.vars, capVar)
|
||||
return s.newValue3(ssa.OpSliceMake, slice.Type, p, l, c)
|
||||
}
|
||||
|
||||
// minMax converts an OMIN/OMAX builtin call into SSA.
|
||||
func (s *state) minMax(n *ir.CallExpr) *ssa.Value {
|
||||
// The OMIN/OMAX builtin is variadic, but its semantics are
|
||||
|
|
|
|||
|
|
@ -444,6 +444,19 @@ func testBitwiseRshU_ssa(a uint32, b, c uint32) uint32 {
|
|||
return a >> b >> c
|
||||
}
|
||||
|
||||
//go:noinline
|
||||
func orLt_ssa(x int) bool {
|
||||
y := x - x
|
||||
return (x | 2) < y
|
||||
}
|
||||
|
||||
// test riscv64 SLTI rules
|
||||
func testSetIfLessThan(t *testing.T) {
|
||||
if want, got := true, orLt_ssa(-7); got != want {
|
||||
t.Errorf("orLt_ssa(-7) = %t want %t", got, want)
|
||||
}
|
||||
}
|
||||
|
||||
//go:noinline
|
||||
func testShiftCX_ssa() int {
|
||||
v1 := uint8(3)
|
||||
|
|
@ -977,6 +990,7 @@ func TestArithmetic(t *testing.T) {
|
|||
testRegallocCVSpill(t)
|
||||
testSubqToNegq(t)
|
||||
testBitwiseLogic(t)
|
||||
testSetIfLessThan(t)
|
||||
testOcom(t)
|
||||
testLrot(t)
|
||||
testShiftCX(t)
|
||||
|
|
|
|||
|
|
@ -195,6 +195,7 @@ func makeslice(typ *byte, len int, cap int) unsafe.Pointer
|
|||
func makeslice64(typ *byte, len int64, cap int64) unsafe.Pointer
|
||||
func makeslicecopy(typ *byte, tolen int, fromlen int, from unsafe.Pointer) unsafe.Pointer
|
||||
func growslice(oldPtr *any, newLen, oldCap, num int, et *byte) (ary []any)
|
||||
func growsliceBuf(oldPtr *any, newLen, oldCap, num int, et *byte, buf *any, bufLen int) (ary []any)
|
||||
func unsafeslicecheckptr(typ *byte, ptr unsafe.Pointer, len int64)
|
||||
func panicunsafeslicelen()
|
||||
func panicunsafeslicenilptr()
|
||||
|
|
@ -202,6 +203,11 @@ func unsafestringcheckptr(ptr unsafe.Pointer, len int64)
|
|||
func panicunsafestringlen()
|
||||
func panicunsafestringnilptr()
|
||||
|
||||
func moveSlice(typ *byte, old *byte, len, cap int) (*byte, int, int)
|
||||
func moveSliceNoScan(elemSize uintptr, old *byte, len, cap int) (*byte, int, int)
|
||||
func moveSliceNoCap(typ *byte, old *byte, len int) (*byte, int, int)
|
||||
func moveSliceNoCapNoScan(elemSize uintptr, old *byte, len int) (*byte, int, int)
|
||||
|
||||
func memmove(to *any, frm *any, length uintptr)
|
||||
func memclrNoHeapPointers(ptr unsafe.Pointer, n uintptr)
|
||||
func memclrHasPointers(ptr unsafe.Pointer, n uintptr)
|
||||
|
|
|
|||
|
|
@ -160,80 +160,85 @@ var runtimeDecls = [...]struct {
|
|||
{"makeslice64", funcTag, 124},
|
||||
{"makeslicecopy", funcTag, 125},
|
||||
{"growslice", funcTag, 127},
|
||||
{"unsafeslicecheckptr", funcTag, 128},
|
||||
{"growsliceBuf", funcTag, 128},
|
||||
{"unsafeslicecheckptr", funcTag, 129},
|
||||
{"panicunsafeslicelen", funcTag, 9},
|
||||
{"panicunsafeslicenilptr", funcTag, 9},
|
||||
{"unsafestringcheckptr", funcTag, 129},
|
||||
{"unsafestringcheckptr", funcTag, 130},
|
||||
{"panicunsafestringlen", funcTag, 9},
|
||||
{"panicunsafestringnilptr", funcTag, 9},
|
||||
{"memmove", funcTag, 130},
|
||||
{"memclrNoHeapPointers", funcTag, 131},
|
||||
{"memclrHasPointers", funcTag, 131},
|
||||
{"memequal", funcTag, 132},
|
||||
{"memequal0", funcTag, 133},
|
||||
{"memequal8", funcTag, 133},
|
||||
{"memequal16", funcTag, 133},
|
||||
{"memequal32", funcTag, 133},
|
||||
{"memequal64", funcTag, 133},
|
||||
{"memequal128", funcTag, 133},
|
||||
{"f32equal", funcTag, 134},
|
||||
{"f64equal", funcTag, 134},
|
||||
{"c64equal", funcTag, 134},
|
||||
{"c128equal", funcTag, 134},
|
||||
{"strequal", funcTag, 134},
|
||||
{"interequal", funcTag, 134},
|
||||
{"nilinterequal", funcTag, 134},
|
||||
{"memhash", funcTag, 135},
|
||||
{"memhash0", funcTag, 136},
|
||||
{"memhash8", funcTag, 136},
|
||||
{"memhash16", funcTag, 136},
|
||||
{"memhash32", funcTag, 136},
|
||||
{"memhash64", funcTag, 136},
|
||||
{"memhash128", funcTag, 136},
|
||||
{"f32hash", funcTag, 137},
|
||||
{"f64hash", funcTag, 137},
|
||||
{"c64hash", funcTag, 137},
|
||||
{"c128hash", funcTag, 137},
|
||||
{"strhash", funcTag, 137},
|
||||
{"interhash", funcTag, 137},
|
||||
{"nilinterhash", funcTag, 137},
|
||||
{"int64div", funcTag, 138},
|
||||
{"uint64div", funcTag, 139},
|
||||
{"int64mod", funcTag, 138},
|
||||
{"uint64mod", funcTag, 139},
|
||||
{"float64toint64", funcTag, 140},
|
||||
{"float64touint64", funcTag, 141},
|
||||
{"float64touint32", funcTag, 142},
|
||||
{"int64tofloat64", funcTag, 143},
|
||||
{"int64tofloat32", funcTag, 144},
|
||||
{"uint64tofloat64", funcTag, 145},
|
||||
{"uint64tofloat32", funcTag, 146},
|
||||
{"uint32tofloat64", funcTag, 147},
|
||||
{"complex128div", funcTag, 148},
|
||||
{"moveSlice", funcTag, 131},
|
||||
{"moveSliceNoScan", funcTag, 132},
|
||||
{"moveSliceNoCap", funcTag, 133},
|
||||
{"moveSliceNoCapNoScan", funcTag, 134},
|
||||
{"memmove", funcTag, 135},
|
||||
{"memclrNoHeapPointers", funcTag, 136},
|
||||
{"memclrHasPointers", funcTag, 136},
|
||||
{"memequal", funcTag, 137},
|
||||
{"memequal0", funcTag, 138},
|
||||
{"memequal8", funcTag, 138},
|
||||
{"memequal16", funcTag, 138},
|
||||
{"memequal32", funcTag, 138},
|
||||
{"memequal64", funcTag, 138},
|
||||
{"memequal128", funcTag, 138},
|
||||
{"f32equal", funcTag, 139},
|
||||
{"f64equal", funcTag, 139},
|
||||
{"c64equal", funcTag, 139},
|
||||
{"c128equal", funcTag, 139},
|
||||
{"strequal", funcTag, 139},
|
||||
{"interequal", funcTag, 139},
|
||||
{"nilinterequal", funcTag, 139},
|
||||
{"memhash", funcTag, 140},
|
||||
{"memhash0", funcTag, 141},
|
||||
{"memhash8", funcTag, 141},
|
||||
{"memhash16", funcTag, 141},
|
||||
{"memhash32", funcTag, 141},
|
||||
{"memhash64", funcTag, 141},
|
||||
{"memhash128", funcTag, 141},
|
||||
{"f32hash", funcTag, 142},
|
||||
{"f64hash", funcTag, 142},
|
||||
{"c64hash", funcTag, 142},
|
||||
{"c128hash", funcTag, 142},
|
||||
{"strhash", funcTag, 142},
|
||||
{"interhash", funcTag, 142},
|
||||
{"nilinterhash", funcTag, 142},
|
||||
{"int64div", funcTag, 143},
|
||||
{"uint64div", funcTag, 144},
|
||||
{"int64mod", funcTag, 143},
|
||||
{"uint64mod", funcTag, 144},
|
||||
{"float64toint64", funcTag, 145},
|
||||
{"float64touint64", funcTag, 146},
|
||||
{"float64touint32", funcTag, 147},
|
||||
{"int64tofloat64", funcTag, 148},
|
||||
{"int64tofloat32", funcTag, 149},
|
||||
{"uint64tofloat64", funcTag, 150},
|
||||
{"uint64tofloat32", funcTag, 151},
|
||||
{"uint32tofloat64", funcTag, 152},
|
||||
{"complex128div", funcTag, 153},
|
||||
{"racefuncenter", funcTag, 33},
|
||||
{"racefuncexit", funcTag, 9},
|
||||
{"raceread", funcTag, 33},
|
||||
{"racewrite", funcTag, 33},
|
||||
{"racereadrange", funcTag, 149},
|
||||
{"racewriterange", funcTag, 149},
|
||||
{"msanread", funcTag, 149},
|
||||
{"msanwrite", funcTag, 149},
|
||||
{"msanmove", funcTag, 150},
|
||||
{"asanread", funcTag, 149},
|
||||
{"asanwrite", funcTag, 149},
|
||||
{"checkptrAlignment", funcTag, 151},
|
||||
{"checkptrArithmetic", funcTag, 153},
|
||||
{"libfuzzerTraceCmp1", funcTag, 154},
|
||||
{"libfuzzerTraceCmp2", funcTag, 155},
|
||||
{"libfuzzerTraceCmp4", funcTag, 156},
|
||||
{"libfuzzerTraceCmp8", funcTag, 157},
|
||||
{"libfuzzerTraceConstCmp1", funcTag, 154},
|
||||
{"libfuzzerTraceConstCmp2", funcTag, 155},
|
||||
{"libfuzzerTraceConstCmp4", funcTag, 156},
|
||||
{"libfuzzerTraceConstCmp8", funcTag, 157},
|
||||
{"libfuzzerHookStrCmp", funcTag, 158},
|
||||
{"libfuzzerHookEqualFold", funcTag, 158},
|
||||
{"addCovMeta", funcTag, 160},
|
||||
{"racereadrange", funcTag, 154},
|
||||
{"racewriterange", funcTag, 154},
|
||||
{"msanread", funcTag, 154},
|
||||
{"msanwrite", funcTag, 154},
|
||||
{"msanmove", funcTag, 155},
|
||||
{"asanread", funcTag, 154},
|
||||
{"asanwrite", funcTag, 154},
|
||||
{"checkptrAlignment", funcTag, 156},
|
||||
{"checkptrArithmetic", funcTag, 158},
|
||||
{"libfuzzerTraceCmp1", funcTag, 159},
|
||||
{"libfuzzerTraceCmp2", funcTag, 160},
|
||||
{"libfuzzerTraceCmp4", funcTag, 161},
|
||||
{"libfuzzerTraceCmp8", funcTag, 162},
|
||||
{"libfuzzerTraceConstCmp1", funcTag, 159},
|
||||
{"libfuzzerTraceConstCmp2", funcTag, 160},
|
||||
{"libfuzzerTraceConstCmp4", funcTag, 161},
|
||||
{"libfuzzerTraceConstCmp8", funcTag, 162},
|
||||
{"libfuzzerHookStrCmp", funcTag, 163},
|
||||
{"libfuzzerHookEqualFold", funcTag, 163},
|
||||
{"addCovMeta", funcTag, 165},
|
||||
{"x86HasAVX", varTag, 6},
|
||||
{"x86HasFMA", varTag, 6},
|
||||
{"x86HasPOPCNT", varTag, 6},
|
||||
|
|
@ -244,11 +249,11 @@ var runtimeDecls = [...]struct {
|
|||
{"loong64HasLAM_BH", varTag, 6},
|
||||
{"loong64HasLSX", varTag, 6},
|
||||
{"riscv64HasZbb", varTag, 6},
|
||||
{"asanregisterglobals", funcTag, 131},
|
||||
{"asanregisterglobals", funcTag, 136},
|
||||
}
|
||||
|
||||
func runtimeTypes() []*types.Type {
|
||||
var typs [161]*types.Type
|
||||
var typs [166]*types.Type
|
||||
typs[0] = types.ByteType
|
||||
typs[1] = types.NewPtr(typs[0])
|
||||
typs[2] = types.Types[types.TANY]
|
||||
|
|
@ -377,39 +382,44 @@ func runtimeTypes() []*types.Type {
|
|||
typs[125] = newSig(params(typs[1], typs[13], typs[13], typs[7]), params(typs[7]))
|
||||
typs[126] = types.NewSlice(typs[2])
|
||||
typs[127] = newSig(params(typs[3], typs[13], typs[13], typs[13], typs[1]), params(typs[126]))
|
||||
typs[128] = newSig(params(typs[1], typs[7], typs[22]), nil)
|
||||
typs[129] = newSig(params(typs[7], typs[22]), nil)
|
||||
typs[130] = newSig(params(typs[3], typs[3], typs[5]), nil)
|
||||
typs[131] = newSig(params(typs[7], typs[5]), nil)
|
||||
typs[132] = newSig(params(typs[3], typs[3], typs[5]), params(typs[6]))
|
||||
typs[133] = newSig(params(typs[3], typs[3]), params(typs[6]))
|
||||
typs[134] = newSig(params(typs[7], typs[7]), params(typs[6]))
|
||||
typs[135] = newSig(params(typs[3], typs[5], typs[5]), params(typs[5]))
|
||||
typs[136] = newSig(params(typs[7], typs[5]), params(typs[5]))
|
||||
typs[137] = newSig(params(typs[3], typs[5]), params(typs[5]))
|
||||
typs[138] = newSig(params(typs[22], typs[22]), params(typs[22]))
|
||||
typs[139] = newSig(params(typs[24], typs[24]), params(typs[24]))
|
||||
typs[140] = newSig(params(typs[18]), params(typs[22]))
|
||||
typs[141] = newSig(params(typs[18]), params(typs[24]))
|
||||
typs[142] = newSig(params(typs[18]), params(typs[67]))
|
||||
typs[143] = newSig(params(typs[22]), params(typs[18]))
|
||||
typs[144] = newSig(params(typs[22]), params(typs[20]))
|
||||
typs[145] = newSig(params(typs[24]), params(typs[18]))
|
||||
typs[146] = newSig(params(typs[24]), params(typs[20]))
|
||||
typs[147] = newSig(params(typs[67]), params(typs[18]))
|
||||
typs[148] = newSig(params(typs[26], typs[26]), params(typs[26]))
|
||||
typs[149] = newSig(params(typs[5], typs[5]), nil)
|
||||
typs[150] = newSig(params(typs[5], typs[5], typs[5]), nil)
|
||||
typs[151] = newSig(params(typs[7], typs[1], typs[5]), nil)
|
||||
typs[152] = types.NewSlice(typs[7])
|
||||
typs[153] = newSig(params(typs[7], typs[152]), nil)
|
||||
typs[154] = newSig(params(typs[71], typs[71], typs[15]), nil)
|
||||
typs[155] = newSig(params(typs[65], typs[65], typs[15]), nil)
|
||||
typs[156] = newSig(params(typs[67], typs[67], typs[15]), nil)
|
||||
typs[157] = newSig(params(typs[24], typs[24], typs[15]), nil)
|
||||
typs[158] = newSig(params(typs[30], typs[30], typs[15]), nil)
|
||||
typs[159] = types.NewArray(typs[0], 16)
|
||||
typs[160] = newSig(params(typs[7], typs[67], typs[159], typs[30], typs[13], typs[71], typs[71]), params(typs[67]))
|
||||
typs[128] = newSig(params(typs[3], typs[13], typs[13], typs[13], typs[1], typs[3], typs[13]), params(typs[126]))
|
||||
typs[129] = newSig(params(typs[1], typs[7], typs[22]), nil)
|
||||
typs[130] = newSig(params(typs[7], typs[22]), nil)
|
||||
typs[131] = newSig(params(typs[1], typs[1], typs[13], typs[13]), params(typs[1], typs[13], typs[13]))
|
||||
typs[132] = newSig(params(typs[5], typs[1], typs[13], typs[13]), params(typs[1], typs[13], typs[13]))
|
||||
typs[133] = newSig(params(typs[1], typs[1], typs[13]), params(typs[1], typs[13], typs[13]))
|
||||
typs[134] = newSig(params(typs[5], typs[1], typs[13]), params(typs[1], typs[13], typs[13]))
|
||||
typs[135] = newSig(params(typs[3], typs[3], typs[5]), nil)
|
||||
typs[136] = newSig(params(typs[7], typs[5]), nil)
|
||||
typs[137] = newSig(params(typs[3], typs[3], typs[5]), params(typs[6]))
|
||||
typs[138] = newSig(params(typs[3], typs[3]), params(typs[6]))
|
||||
typs[139] = newSig(params(typs[7], typs[7]), params(typs[6]))
|
||||
typs[140] = newSig(params(typs[3], typs[5], typs[5]), params(typs[5]))
|
||||
typs[141] = newSig(params(typs[7], typs[5]), params(typs[5]))
|
||||
typs[142] = newSig(params(typs[3], typs[5]), params(typs[5]))
|
||||
typs[143] = newSig(params(typs[22], typs[22]), params(typs[22]))
|
||||
typs[144] = newSig(params(typs[24], typs[24]), params(typs[24]))
|
||||
typs[145] = newSig(params(typs[18]), params(typs[22]))
|
||||
typs[146] = newSig(params(typs[18]), params(typs[24]))
|
||||
typs[147] = newSig(params(typs[18]), params(typs[67]))
|
||||
typs[148] = newSig(params(typs[22]), params(typs[18]))
|
||||
typs[149] = newSig(params(typs[22]), params(typs[20]))
|
||||
typs[150] = newSig(params(typs[24]), params(typs[18]))
|
||||
typs[151] = newSig(params(typs[24]), params(typs[20]))
|
||||
typs[152] = newSig(params(typs[67]), params(typs[18]))
|
||||
typs[153] = newSig(params(typs[26], typs[26]), params(typs[26]))
|
||||
typs[154] = newSig(params(typs[5], typs[5]), nil)
|
||||
typs[155] = newSig(params(typs[5], typs[5], typs[5]), nil)
|
||||
typs[156] = newSig(params(typs[7], typs[1], typs[5]), nil)
|
||||
typs[157] = types.NewSlice(typs[7])
|
||||
typs[158] = newSig(params(typs[7], typs[157]), nil)
|
||||
typs[159] = newSig(params(typs[71], typs[71], typs[15]), nil)
|
||||
typs[160] = newSig(params(typs[65], typs[65], typs[15]), nil)
|
||||
typs[161] = newSig(params(typs[67], typs[67], typs[15]), nil)
|
||||
typs[162] = newSig(params(typs[24], typs[24], typs[15]), nil)
|
||||
typs[163] = newSig(params(typs[30], typs[30], typs[15]), nil)
|
||||
typs[164] = types.NewArray(typs[0], 16)
|
||||
typs[165] = newSig(params(typs[7], typs[67], typs[164], typs[30], typs[13], typs[71], typs[71]), params(typs[67]))
|
||||
return typs[:]
|
||||
}
|
||||
|
||||
|
|
|
|||
|
|
@ -1842,26 +1842,7 @@ func IsReflexive(t *Type) bool {
|
|||
// Can this type be stored directly in an interface word?
|
||||
// Yes, if the representation is a single pointer.
|
||||
func IsDirectIface(t *Type) bool {
|
||||
switch t.Kind() {
|
||||
case TPTR:
|
||||
// Pointers to notinheap types must be stored indirectly. See issue 42076.
|
||||
return !t.Elem().NotInHeap()
|
||||
case TCHAN,
|
||||
TMAP,
|
||||
TFUNC,
|
||||
TUNSAFEPTR:
|
||||
return true
|
||||
|
||||
case TARRAY:
|
||||
// Array of 1 direct iface type can be direct.
|
||||
return t.NumElem() == 1 && IsDirectIface(t.Elem())
|
||||
|
||||
case TSTRUCT:
|
||||
// Struct with 1 field of direct iface type can be direct.
|
||||
return t.NumFields() == 1 && IsDirectIface(t.Field(0).Type)
|
||||
}
|
||||
|
||||
return false
|
||||
return t.Size() == int64(PtrSize) && PtrDataSize(t) == int64(PtrSize)
|
||||
}
|
||||
|
||||
// IsInterfaceMethod reports whether (field) m is
|
||||
|
|
|
|||
|
|
@ -171,12 +171,13 @@ type Checker struct {
|
|||
usedPkgNames map[*PkgName]bool // set of used package names
|
||||
mono monoGraph // graph for detecting non-monomorphizable instantiation loops
|
||||
|
||||
firstErr error // first error encountered
|
||||
methods map[*TypeName][]*Func // maps package scope type names to associated non-blank (non-interface) methods
|
||||
untyped map[syntax.Expr]exprInfo // map of expressions without final type
|
||||
delayed []action // stack of delayed action segments; segments are processed in FIFO order
|
||||
objPath []Object // path of object dependencies during type inference (for cycle reporting)
|
||||
cleaners []cleaner // list of types that may need a final cleanup at the end of type-checking
|
||||
firstErr error // first error encountered
|
||||
methods map[*TypeName][]*Func // maps package scope type names to associated non-blank (non-interface) methods
|
||||
untyped map[syntax.Expr]exprInfo // map of expressions without final type
|
||||
delayed []action // stack of delayed action segments; segments are processed in FIFO order
|
||||
objPath []Object // path of object dependencies during type-checking (for cycle reporting)
|
||||
objPathIdx map[Object]int // map of object to object path index during type-checking (for cycle reporting)
|
||||
cleaners []cleaner // list of types that may need a final cleanup at the end of type-checking
|
||||
|
||||
// environment within which the current object is type-checked (valid only
|
||||
// for the duration of type-checking a specific object)
|
||||
|
|
@ -248,19 +249,22 @@ func (check *Checker) later(f func()) *action {
|
|||
return &check.delayed[i]
|
||||
}
|
||||
|
||||
// push pushes obj onto the object path and returns its index in the path.
|
||||
func (check *Checker) push(obj Object) int {
|
||||
// push pushes obj onto the object path and records its index in the path index map.
|
||||
func (check *Checker) push(obj Object) {
|
||||
if check.objPathIdx == nil {
|
||||
check.objPathIdx = make(map[Object]int)
|
||||
}
|
||||
check.objPathIdx[obj] = len(check.objPath)
|
||||
check.objPath = append(check.objPath, obj)
|
||||
return len(check.objPath) - 1
|
||||
}
|
||||
|
||||
// pop pops and returns the topmost object from the object path.
|
||||
func (check *Checker) pop() Object {
|
||||
// pop pops an object from the object path and removes it from the path index map.
|
||||
func (check *Checker) pop() {
|
||||
i := len(check.objPath) - 1
|
||||
obj := check.objPath[i]
|
||||
check.objPath[i] = nil
|
||||
check.objPath[i] = nil // help the garbage collector
|
||||
check.objPath = check.objPath[:i]
|
||||
return obj
|
||||
delete(check.objPathIdx, obj)
|
||||
}
|
||||
|
||||
type cleaner interface {
|
||||
|
|
@ -319,6 +323,7 @@ func (check *Checker) initFiles(files []*syntax.File) {
|
|||
check.untyped = nil
|
||||
check.delayed = nil
|
||||
check.objPath = nil
|
||||
check.objPathIdx = nil
|
||||
check.cleaners = nil
|
||||
|
||||
// We must initialize usedVars and usedPkgNames both here and in NewChecker,
|
||||
|
|
|
|||
|
|
@ -54,7 +54,6 @@ func (check *Checker) directCycle(tname *TypeName, pathIdx map[*TypeName]int) {
|
|||
// tname is marked grey - we have a cycle on the path beginning at start.
|
||||
// Mark tname as invalid.
|
||||
tname.setType(Typ[Invalid])
|
||||
tname.setColor(black)
|
||||
|
||||
// collect type names on cycle
|
||||
var cycle []Object
|
||||
|
|
|
|||
|
|
@ -62,114 +62,77 @@ func (check *Checker) objDecl(obj Object, def *TypeName) {
|
|||
if check.indent == 0 {
|
||||
fmt.Println() // empty line between top-level objects for readability
|
||||
}
|
||||
check.trace(obj.Pos(), "-- checking %s (%s, objPath = %s)", obj, obj.color(), pathString(check.objPath))
|
||||
check.trace(obj.Pos(), "-- checking %s (objPath = %s)", obj, pathString(check.objPath))
|
||||
check.indent++
|
||||
defer func() {
|
||||
check.indent--
|
||||
check.trace(obj.Pos(), "=> %s (%s)", obj, obj.color())
|
||||
check.trace(obj.Pos(), "=> %s", obj)
|
||||
}()
|
||||
}
|
||||
|
||||
// Checking the declaration of obj means inferring its type
|
||||
// (and possibly its value, for constants).
|
||||
// An object's type (and thus the object) may be in one of
|
||||
// three states which are expressed by colors:
|
||||
// Checking the declaration of an object means determining its type
|
||||
// (and also its value for constants). An object (and thus its type)
|
||||
// may be in 1 of 3 states:
|
||||
//
|
||||
// - an object whose type is not yet known is painted white (initial color)
|
||||
// - an object whose type is in the process of being inferred is painted grey
|
||||
// - an object whose type is fully inferred is painted black
|
||||
// - not in Checker.objPathIdx and type == nil : type is not yet known (white)
|
||||
// - in Checker.objPathIdx : type is pending (grey)
|
||||
// - not in Checker.objPathIdx and type != nil : type is known (black)
|
||||
//
|
||||
// During type inference, an object's color changes from white to grey
|
||||
// to black (pre-declared objects are painted black from the start).
|
||||
// A black object (i.e., its type) can only depend on (refer to) other black
|
||||
// ones. White and grey objects may depend on white and black objects.
|
||||
// A dependency on a grey object indicates a cycle which may or may not be
|
||||
// valid.
|
||||
// During type-checking, an object changes from white to grey to black.
|
||||
// Predeclared objects start as black (their type is known without checking).
|
||||
//
|
||||
// When objects turn grey, they are pushed on the object path (a stack);
|
||||
// they are popped again when they turn black. Thus, if a grey object (a
|
||||
// cycle) is encountered, it is on the object path, and all the objects
|
||||
// it depends on are the remaining objects on that path. Color encoding
|
||||
// is such that the color value of a grey object indicates the index of
|
||||
// that object in the object path.
|
||||
// A black object may only depend on (refer to) to other black objects. White
|
||||
// and grey objects may depend on white or black objects. A dependency on a
|
||||
// grey object indicates a (possibly invalid) cycle.
|
||||
//
|
||||
// When an object is marked grey, it is pushed onto the object path (a stack)
|
||||
// and its index in the path is recorded in the path index map. It is popped
|
||||
// and removed from the map when its type is determined (and marked black).
|
||||
|
||||
// During type-checking, white objects may be assigned a type without
|
||||
// traversing through objDecl; e.g., when initializing constants and
|
||||
// variables. Update the colors of those objects here (rather than
|
||||
// everywhere where we set the type) to satisfy the color invariants.
|
||||
if obj.color() == white && obj.Type() != nil {
|
||||
obj.setColor(black)
|
||||
return
|
||||
}
|
||||
|
||||
switch obj.color() {
|
||||
case white:
|
||||
assert(obj.Type() == nil)
|
||||
// All color values other than white and black are considered grey.
|
||||
// Because black and white are < grey, all values >= grey are grey.
|
||||
// Use those values to encode the object's index into the object path.
|
||||
obj.setColor(grey + color(check.push(obj)))
|
||||
defer func() {
|
||||
check.pop().setColor(black)
|
||||
}()
|
||||
|
||||
case black:
|
||||
assert(obj.Type() != nil)
|
||||
return
|
||||
|
||||
default:
|
||||
// Color values other than white or black are considered grey.
|
||||
fallthrough
|
||||
|
||||
case grey:
|
||||
// We have a (possibly invalid) cycle.
|
||||
// In the existing code, this is marked by a non-nil type
|
||||
// for the object except for constants and variables whose
|
||||
// type may be non-nil (known), or nil if it depends on the
|
||||
// not-yet known initialization value.
|
||||
// In the former case, set the type to Typ[Invalid] because
|
||||
// we have an initialization cycle. The cycle error will be
|
||||
// reported later, when determining initialization order.
|
||||
// TODO(gri) Report cycle here and simplify initialization
|
||||
// order code.
|
||||
// If this object is grey, we have a (possibly invalid) cycle. This is signaled
|
||||
// by a non-nil type for the object, except for constants and variables whose
|
||||
// type may be non-nil (known), or nil if it depends on a not-yet known
|
||||
// initialization value.
|
||||
//
|
||||
// In the former case, set the type to Typ[Invalid] because we have an
|
||||
// initialization cycle. The cycle error will be reported later, when
|
||||
// determining initialization order.
|
||||
//
|
||||
// TODO(gri) Report cycle here and simplify initialization order code.
|
||||
if _, ok := check.objPathIdx[obj]; ok {
|
||||
switch obj := obj.(type) {
|
||||
case *Const:
|
||||
if !check.validCycle(obj) || obj.typ == nil {
|
||||
obj.typ = Typ[Invalid]
|
||||
case *Const, *Var:
|
||||
if !check.validCycle(obj) || obj.Type() == nil {
|
||||
obj.setType(Typ[Invalid])
|
||||
}
|
||||
|
||||
case *Var:
|
||||
if !check.validCycle(obj) || obj.typ == nil {
|
||||
obj.typ = Typ[Invalid]
|
||||
}
|
||||
|
||||
case *TypeName:
|
||||
if !check.validCycle(obj) {
|
||||
// break cycle
|
||||
// (without this, calling underlying()
|
||||
// below may lead to an endless loop
|
||||
// if we have a cycle for a defined
|
||||
// (*Named) type)
|
||||
obj.typ = Typ[Invalid]
|
||||
obj.setType(Typ[Invalid])
|
||||
}
|
||||
|
||||
case *Func:
|
||||
if !check.validCycle(obj) {
|
||||
// Don't set obj.typ to Typ[Invalid] here
|
||||
// because plenty of code type-asserts that
|
||||
// functions have a *Signature type. Grey
|
||||
// functions have their type set to an empty
|
||||
// signature which makes it impossible to
|
||||
// Don't set type to Typ[Invalid]; plenty of code asserts that
|
||||
// functions have a *Signature type. Instead, leave the type
|
||||
// as an empty signature, which makes it impossible to
|
||||
// initialize a variable with the function.
|
||||
}
|
||||
|
||||
default:
|
||||
panic("unreachable")
|
||||
}
|
||||
|
||||
assert(obj.Type() != nil)
|
||||
return
|
||||
}
|
||||
|
||||
if obj.Type() != nil { // black, meaning it's already type-checked
|
||||
return
|
||||
}
|
||||
|
||||
// white, meaning it must be type-checked
|
||||
|
||||
check.push(obj)
|
||||
defer check.pop()
|
||||
|
||||
d := check.objMap[obj]
|
||||
if d == nil {
|
||||
check.dump("%v: %s should have been declared", obj.Pos(), obj)
|
||||
|
|
@ -221,8 +184,8 @@ func (check *Checker) validCycle(obj Object) (valid bool) {
|
|||
}
|
||||
|
||||
// Count cycle objects.
|
||||
assert(obj.color() >= grey)
|
||||
start := obj.color() - grey // index of obj in objPath
|
||||
start, found := check.objPathIdx[obj]
|
||||
assert(found)
|
||||
cycle := check.objPath[start:]
|
||||
tparCycle := false // if set, the cycle is through a type parameter list
|
||||
nval := 0 // number of (constant or variable) values in the cycle
|
||||
|
|
@ -532,11 +495,16 @@ func (check *Checker) typeDecl(obj *TypeName, tdecl *syntax.TypeDecl, def *TypeN
|
|||
check.collectTypeParams(&alias.tparams, tdecl.TParamList)
|
||||
}
|
||||
|
||||
rhs = check.definedType(tdecl.Type, obj)
|
||||
rhs = check.declaredType(tdecl.Type, obj)
|
||||
assert(rhs != nil)
|
||||
|
||||
alias.fromRHS = rhs
|
||||
unalias(alias) // populate alias.actual
|
||||
|
||||
// spec: In an alias declaration the given type cannot be a type parameter declared in the same declaration."
|
||||
// (see also go.dev/issue/75884, go.dev/issue/#75885)
|
||||
if tpar, ok := rhs.(*TypeParam); ok && alias.tparams != nil && slices.Index(alias.tparams.list(), tpar) >= 0 {
|
||||
check.error(tdecl.Type, MisplacedTypeParam, "cannot use type parameter declared in alias declaration as RHS")
|
||||
alias.fromRHS = Typ[Invalid]
|
||||
}
|
||||
} else {
|
||||
if !versionErr && tparam0 != nil {
|
||||
check.error(tdecl, UnsupportedFeature, "generic type alias requires GODEBUG=gotypesalias=1 or unset")
|
||||
|
|
@ -576,7 +544,7 @@ func (check *Checker) typeDecl(obj *TypeName, tdecl *syntax.TypeDecl, def *TypeN
|
|||
check.collectTypeParams(&named.tparams, tdecl.TParamList)
|
||||
}
|
||||
|
||||
rhs = check.definedType(tdecl.Type, obj)
|
||||
rhs = check.declaredType(tdecl.Type, obj)
|
||||
assert(rhs != nil)
|
||||
named.fromRHS = rhs
|
||||
|
||||
|
|
@ -764,17 +732,8 @@ func (check *Checker) funcDecl(obj *Func, decl *declInfo) {
|
|||
sig := new(Signature)
|
||||
obj.typ = sig // guard against cycles
|
||||
|
||||
// Avoid cycle error when referring to method while type-checking the signature.
|
||||
// This avoids a nuisance in the best case (non-parameterized receiver type) and
|
||||
// since the method is not a type, we get an error. If we have a parameterized
|
||||
// receiver type, instantiating the receiver type leads to the instantiation of
|
||||
// its methods, and we don't want a cycle error in that case.
|
||||
// TODO(gri) review if this is correct and/or whether we still need this?
|
||||
saved := obj.color_
|
||||
obj.color_ = black
|
||||
fdecl := decl.fdecl
|
||||
check.funcType(sig, fdecl.Recv, fdecl.TParamList, fdecl.Type)
|
||||
obj.color_ = saved
|
||||
|
||||
// Set the scope's extent to the complete "func (...) { ... }"
|
||||
// so that Scope.Innermost works correctly.
|
||||
|
|
@ -921,10 +880,9 @@ func (check *Checker) declStmt(list []syntax.Decl) {
|
|||
// the innermost containing block."
|
||||
scopePos := s.Name.Pos()
|
||||
check.declare(check.scope, s.Name, obj, scopePos)
|
||||
// mark and unmark type before calling typeDecl; its type is still nil (see Checker.objDecl)
|
||||
obj.setColor(grey + color(check.push(obj)))
|
||||
check.push(obj) // mark as grey
|
||||
check.typeDecl(obj, s, nil)
|
||||
check.pop().setColor(black)
|
||||
check.pop()
|
||||
|
||||
default:
|
||||
check.errorf(s, InvalidSyntaxTree, "unknown syntax.Decl node %T", s)
|
||||
|
|
|
|||
|
|
@ -42,18 +42,12 @@ type Object interface {
|
|||
// 0 for all other objects (including objects in file scopes).
|
||||
order() uint32
|
||||
|
||||
// color returns the object's color.
|
||||
color() color
|
||||
|
||||
// setType sets the type of the object.
|
||||
setType(Type)
|
||||
|
||||
// setOrder sets the order number of the object. It must be > 0.
|
||||
setOrder(uint32)
|
||||
|
||||
// setColor sets the object's color. It must not be white.
|
||||
setColor(color color)
|
||||
|
||||
// setParent sets the parent scope of the object.
|
||||
setParent(*Scope)
|
||||
|
||||
|
|
@ -102,41 +96,9 @@ type object struct {
|
|||
name string
|
||||
typ Type
|
||||
order_ uint32
|
||||
color_ color
|
||||
scopePos_ syntax.Pos
|
||||
}
|
||||
|
||||
// color encodes the color of an object (see Checker.objDecl for details).
|
||||
type color uint32
|
||||
|
||||
// An object may be painted in one of three colors.
|
||||
// Color values other than white or black are considered grey.
|
||||
const (
|
||||
white color = iota
|
||||
black
|
||||
grey // must be > white and black
|
||||
)
|
||||
|
||||
func (c color) String() string {
|
||||
switch c {
|
||||
case white:
|
||||
return "white"
|
||||
case black:
|
||||
return "black"
|
||||
default:
|
||||
return "grey"
|
||||
}
|
||||
}
|
||||
|
||||
// colorFor returns the (initial) color for an object depending on
|
||||
// whether its type t is known or not.
|
||||
func colorFor(t Type) color {
|
||||
if t != nil {
|
||||
return black
|
||||
}
|
||||
return white
|
||||
}
|
||||
|
||||
// Parent returns the scope in which the object is declared.
|
||||
// The result is nil for methods and struct fields.
|
||||
func (obj *object) Parent() *Scope { return obj.parent }
|
||||
|
|
@ -164,13 +126,11 @@ func (obj *object) Id() string { return Id(obj.pkg, obj.name) }
|
|||
|
||||
func (obj *object) String() string { panic("abstract") }
|
||||
func (obj *object) order() uint32 { return obj.order_ }
|
||||
func (obj *object) color() color { return obj.color_ }
|
||||
func (obj *object) scopePos() syntax.Pos { return obj.scopePos_ }
|
||||
|
||||
func (obj *object) setParent(parent *Scope) { obj.parent = parent }
|
||||
func (obj *object) setType(typ Type) { obj.typ = typ }
|
||||
func (obj *object) setOrder(order uint32) { assert(order > 0); obj.order_ = order }
|
||||
func (obj *object) setColor(color color) { assert(color != white); obj.color_ = color }
|
||||
func (obj *object) setScopePos(pos syntax.Pos) { obj.scopePos_ = pos }
|
||||
|
||||
func (obj *object) sameId(pkg *Package, name string, foldCase bool) bool {
|
||||
|
|
@ -247,7 +207,7 @@ type PkgName struct {
|
|||
// NewPkgName returns a new PkgName object representing an imported package.
|
||||
// The remaining arguments set the attributes found with all Objects.
|
||||
func NewPkgName(pos syntax.Pos, pkg *Package, name string, imported *Package) *PkgName {
|
||||
return &PkgName{object{nil, pos, pkg, name, Typ[Invalid], 0, black, nopos}, imported}
|
||||
return &PkgName{object{nil, pos, pkg, name, Typ[Invalid], 0, nopos}, imported}
|
||||
}
|
||||
|
||||
// Imported returns the package that was imported.
|
||||
|
|
@ -263,7 +223,7 @@ type Const struct {
|
|||
// NewConst returns a new constant with value val.
|
||||
// The remaining arguments set the attributes found with all Objects.
|
||||
func NewConst(pos syntax.Pos, pkg *Package, name string, typ Type, val constant.Value) *Const {
|
||||
return &Const{object{nil, pos, pkg, name, typ, 0, colorFor(typ), nopos}, val}
|
||||
return &Const{object{nil, pos, pkg, name, typ, 0, nopos}, val}
|
||||
}
|
||||
|
||||
// Val returns the constant's value.
|
||||
|
|
@ -288,7 +248,7 @@ type TypeName struct {
|
|||
// argument for NewNamed, which will set the TypeName's type as a side-
|
||||
// effect.
|
||||
func NewTypeName(pos syntax.Pos, pkg *Package, name string, typ Type) *TypeName {
|
||||
return &TypeName{object{nil, pos, pkg, name, typ, 0, colorFor(typ), nopos}}
|
||||
return &TypeName{object{nil, pos, pkg, name, typ, 0, nopos}}
|
||||
}
|
||||
|
||||
// NewTypeNameLazy returns a new defined type like NewTypeName, but it
|
||||
|
|
@ -402,7 +362,7 @@ func NewField(pos syntax.Pos, pkg *Package, name string, typ Type, embedded bool
|
|||
// newVar returns a new variable.
|
||||
// The arguments set the attributes found with all Objects.
|
||||
func newVar(kind VarKind, pos syntax.Pos, pkg *Package, name string, typ Type) *Var {
|
||||
return &Var{object: object{nil, pos, pkg, name, typ, 0, colorFor(typ), nopos}, kind: kind}
|
||||
return &Var{object: object{nil, pos, pkg, name, typ, 0, nopos}, kind: kind}
|
||||
}
|
||||
|
||||
// Anonymous reports whether the variable is an embedded field.
|
||||
|
|
@ -452,7 +412,7 @@ func NewFunc(pos syntax.Pos, pkg *Package, name string, sig *Signature) *Func {
|
|||
// as this would violate object.{Type,color} invariants.
|
||||
// TODO(adonovan): propose to disallow NewFunc with nil *Signature.
|
||||
}
|
||||
return &Func{object{nil, pos, pkg, name, typ, 0, colorFor(typ), nopos}, false, nil}
|
||||
return &Func{object{nil, pos, pkg, name, typ, 0, nopos}, false, nil}
|
||||
}
|
||||
|
||||
// Signature returns the signature (type) of the function or method.
|
||||
|
|
@ -534,7 +494,7 @@ type Label struct {
|
|||
|
||||
// NewLabel returns a new label.
|
||||
func NewLabel(pos syntax.Pos, pkg *Package, name string) *Label {
|
||||
return &Label{object{pos: pos, pkg: pkg, name: name, typ: Typ[Invalid], color_: black}, false}
|
||||
return &Label{object{pos: pos, pkg: pkg, name: name, typ: Typ[Invalid]}, false}
|
||||
}
|
||||
|
||||
// A Builtin represents a built-in function.
|
||||
|
|
@ -545,7 +505,7 @@ type Builtin struct {
|
|||
}
|
||||
|
||||
func newBuiltin(id builtinId) *Builtin {
|
||||
return &Builtin{object{name: predeclaredFuncs[id].name, typ: Typ[Invalid], color_: black}, id}
|
||||
return &Builtin{object{name: predeclaredFuncs[id].name, typ: Typ[Invalid]}, id}
|
||||
}
|
||||
|
||||
// Nil represents the predeclared value nil.
|
||||
|
|
|
|||
|
|
@ -217,10 +217,8 @@ func (*lazyObject) Exported() bool { panic("unreachable") }
|
|||
func (*lazyObject) Id() string { panic("unreachable") }
|
||||
func (*lazyObject) String() string { panic("unreachable") }
|
||||
func (*lazyObject) order() uint32 { panic("unreachable") }
|
||||
func (*lazyObject) color() color { panic("unreachable") }
|
||||
func (*lazyObject) setType(Type) { panic("unreachable") }
|
||||
func (*lazyObject) setOrder(uint32) { panic("unreachable") }
|
||||
func (*lazyObject) setColor(color color) { panic("unreachable") }
|
||||
func (*lazyObject) setParent(*Scope) { panic("unreachable") }
|
||||
func (*lazyObject) sameId(*Package, string, bool) bool { panic("unreachable") }
|
||||
func (*lazyObject) scopePos() syntax.Pos { panic("unreachable") }
|
||||
|
|
|
|||
|
|
@ -36,14 +36,14 @@ func TestSizeof(t *testing.T) {
|
|||
{term{}, 12, 24},
|
||||
|
||||
// Objects
|
||||
{PkgName{}, 60, 96},
|
||||
{Const{}, 64, 104},
|
||||
{TypeName{}, 56, 88},
|
||||
{Var{}, 64, 104},
|
||||
{Func{}, 64, 104},
|
||||
{Label{}, 60, 96},
|
||||
{Builtin{}, 60, 96},
|
||||
{Nil{}, 56, 88},
|
||||
{PkgName{}, 56, 96},
|
||||
{Const{}, 60, 104},
|
||||
{TypeName{}, 52, 88},
|
||||
{Var{}, 60, 104},
|
||||
{Func{}, 60, 104},
|
||||
{Label{}, 56, 96},
|
||||
{Builtin{}, 56, 96},
|
||||
{Nil{}, 52, 88},
|
||||
|
||||
// Misc
|
||||
{Scope{}, 60, 104},
|
||||
|
|
|
|||
|
|
@ -16,7 +16,7 @@ import (
|
|||
|
||||
// ident type-checks identifier e and initializes x with the value or type of e.
|
||||
// If an error occurred, x.mode is set to invalid.
|
||||
// For the meaning of def, see Checker.definedType, below.
|
||||
// For the meaning of def, see Checker.declaredType, below.
|
||||
// If wantType is set, the identifier e is expected to denote a type.
|
||||
func (check *Checker) ident(x *operand, e *syntax.Name, def *TypeName, wantType bool) {
|
||||
x.mode = invalid
|
||||
|
|
@ -149,14 +149,14 @@ func (check *Checker) ident(x *operand, e *syntax.Name, def *TypeName, wantType
|
|||
// typ type-checks the type expression e and returns its type, or Typ[Invalid].
|
||||
// The type must not be an (uninstantiated) generic type.
|
||||
func (check *Checker) typ(e syntax.Expr) Type {
|
||||
return check.definedType(e, nil)
|
||||
return check.declaredType(e, nil)
|
||||
}
|
||||
|
||||
// varType type-checks the type expression e and returns its type, or Typ[Invalid].
|
||||
// The type must not be an (uninstantiated) generic type and it must not be a
|
||||
// constraint interface.
|
||||
func (check *Checker) varType(e syntax.Expr) Type {
|
||||
typ := check.definedType(e, nil)
|
||||
typ := check.declaredType(e, nil)
|
||||
check.validVarType(e, typ)
|
||||
return typ
|
||||
}
|
||||
|
|
@ -187,11 +187,11 @@ func (check *Checker) validVarType(e syntax.Expr, typ Type) {
|
|||
}).describef(e, "check var type %s", typ)
|
||||
}
|
||||
|
||||
// definedType is like typ but also accepts a type name def.
|
||||
// If def != nil, e is the type specification for the type named def, declared
|
||||
// in a type declaration, and def.typ.underlying will be set to the type of e
|
||||
// before any components of e are type-checked.
|
||||
func (check *Checker) definedType(e syntax.Expr, def *TypeName) Type {
|
||||
// declaredType is like typ but also accepts a type name def.
|
||||
// If def != nil, e is the type specification for the [Alias] or [Named] type
|
||||
// named def, and def.typ.fromRHS will be set to the [Type] of e immediately
|
||||
// after its creation.
|
||||
func (check *Checker) declaredType(e syntax.Expr, def *TypeName) Type {
|
||||
typ := check.typInternal(e, def)
|
||||
assert(isTyped(typ))
|
||||
if isGeneric(typ) {
|
||||
|
|
@ -230,7 +230,7 @@ func goTypeName(typ Type) string {
|
|||
}
|
||||
|
||||
// typInternal drives type checking of types.
|
||||
// Must only be called by definedType or genericType.
|
||||
// Must only be called by declaredType or genericType.
|
||||
func (check *Checker) typInternal(e0 syntax.Expr, def *TypeName) (T Type) {
|
||||
if check.conf.Trace {
|
||||
check.trace(e0.Pos(), "-- type %s", e0)
|
||||
|
|
@ -296,7 +296,7 @@ func (check *Checker) typInternal(e0 syntax.Expr, def *TypeName) (T Type) {
|
|||
case *syntax.ParenExpr:
|
||||
// Generic types must be instantiated before they can be used in any form.
|
||||
// Consequently, generic types cannot be parenthesized.
|
||||
return check.definedType(e.X, def)
|
||||
return check.declaredType(e.X, def)
|
||||
|
||||
case *syntax.ArrayType:
|
||||
typ := new(Array)
|
||||
|
|
|
|||
|
|
@ -98,7 +98,6 @@ func defPredeclaredTypes() {
|
|||
// interface.
|
||||
{
|
||||
universeAnyNoAlias = NewTypeName(nopos, nil, "any", &Interface{complete: true, tset: &topTypeSet})
|
||||
universeAnyNoAlias.setColor(black)
|
||||
// ensure that the any TypeName reports a consistent Parent, after
|
||||
// hijacking Universe.Lookup with gotypesalias=0.
|
||||
universeAnyNoAlias.setParent(Universe)
|
||||
|
|
@ -107,7 +106,6 @@ func defPredeclaredTypes() {
|
|||
// into the Universe, but we lean toward the future and insert the Alias
|
||||
// representation.
|
||||
universeAnyAlias = NewTypeName(nopos, nil, "any", nil)
|
||||
universeAnyAlias.setColor(black)
|
||||
_ = NewAlias(universeAnyAlias, universeAnyNoAlias.Type().Underlying()) // Link TypeName and Alias
|
||||
def(universeAnyAlias)
|
||||
}
|
||||
|
|
@ -115,7 +113,6 @@ func defPredeclaredTypes() {
|
|||
// type error interface{ Error() string }
|
||||
{
|
||||
obj := NewTypeName(nopos, nil, "error", nil)
|
||||
obj.setColor(black)
|
||||
typ := (*Checker)(nil).newNamed(obj, nil, nil)
|
||||
|
||||
// error.Error() string
|
||||
|
|
@ -136,7 +133,6 @@ func defPredeclaredTypes() {
|
|||
// type comparable interface{} // marked as comparable
|
||||
{
|
||||
obj := NewTypeName(nopos, nil, "comparable", nil)
|
||||
obj.setColor(black)
|
||||
typ := (*Checker)(nil).newNamed(obj, nil, nil)
|
||||
|
||||
// interface{} // marked as comparable
|
||||
|
|
@ -165,7 +161,7 @@ func defPredeclaredConsts() {
|
|||
}
|
||||
|
||||
func defPredeclaredNil() {
|
||||
def(&Nil{object{name: "nil", typ: Typ[UntypedNil], color_: black}})
|
||||
def(&Nil{object{name: "nil", typ: Typ[UntypedNil]}})
|
||||
}
|
||||
|
||||
// A builtinId is the id of a builtin function.
|
||||
|
|
@ -289,7 +285,7 @@ func init() {
|
|||
// a scope. Objects with exported names are inserted in the unsafe package
|
||||
// scope; other objects are inserted in the universe scope.
|
||||
func def(obj Object) {
|
||||
assert(obj.color() == black)
|
||||
assert(obj.Type() != nil)
|
||||
name := obj.Name()
|
||||
if strings.Contains(name, " ") {
|
||||
return // nothing to do
|
||||
|
|
|
|||
|
|
@ -351,6 +351,11 @@ func walkExpr1(n ir.Node, init *ir.Nodes) ir.Node {
|
|||
|
||||
case ir.OMETHVALUE:
|
||||
return walkMethodValue(n.(*ir.SelectorExpr), init)
|
||||
|
||||
case ir.OMOVE2HEAP:
|
||||
n := n.(*ir.MoveToHeapExpr)
|
||||
n.Slice = walkExpr(n.Slice, init)
|
||||
return n
|
||||
}
|
||||
|
||||
// No return! Each case must return (or panic),
|
||||
|
|
|
|||
|
|
@ -6,12 +6,12 @@ require (
|
|||
github.com/google/pprof v0.0.0-20250630185457-6e76a2b096b5
|
||||
golang.org/x/arch v0.22.1-0.20251016010524-fea4a9ec4938
|
||||
golang.org/x/build v0.0.0-20250806225920-b7c66c047964
|
||||
golang.org/x/mod v0.29.0
|
||||
golang.org/x/sync v0.17.0
|
||||
golang.org/x/sys v0.37.0
|
||||
golang.org/x/telemetry v0.0.0-20251008203120-078029d740a8
|
||||
golang.org/x/mod v0.30.1-0.20251114215501-3f03020ad526
|
||||
golang.org/x/sync v0.18.0
|
||||
golang.org/x/sys v0.38.0
|
||||
golang.org/x/telemetry v0.0.0-20251111182119-bc8e575c7b54
|
||||
golang.org/x/term v0.34.0
|
||||
golang.org/x/tools v0.38.1-0.20251015192825-7d9453ccc0f5
|
||||
golang.org/x/tools v0.39.1-0.20251114194111-59ff18ce4883
|
||||
)
|
||||
|
||||
require (
|
||||
|
|
|
|||
|
|
@ -10,19 +10,19 @@ golang.org/x/arch v0.22.1-0.20251016010524-fea4a9ec4938 h1:VJ182b/ajNehMFRltVfCh
|
|||
golang.org/x/arch v0.22.1-0.20251016010524-fea4a9ec4938/go.mod h1:dNHoOeKiyja7GTvF9NJS1l3Z2yntpQNzgrjh1cU103A=
|
||||
golang.org/x/build v0.0.0-20250806225920-b7c66c047964 h1:yRs1K51GKq7hsIO+YHJ8LsslrvwFceNPIv0tYjpcBd0=
|
||||
golang.org/x/build v0.0.0-20250806225920-b7c66c047964/go.mod h1:i9Vx7+aOQUpYJRxSO+OpRStVBCVL/9ccI51xblWm5WY=
|
||||
golang.org/x/mod v0.29.0 h1:HV8lRxZC4l2cr3Zq1LvtOsi/ThTgWnUk/y64QSs8GwA=
|
||||
golang.org/x/mod v0.29.0/go.mod h1:NyhrlYXJ2H4eJiRy/WDBO6HMqZQ6q9nk4JzS3NuCK+w=
|
||||
golang.org/x/sync v0.17.0 h1:l60nONMj9l5drqw6jlhIELNv9I0A4OFgRsG9k2oT9Ug=
|
||||
golang.org/x/sync v0.17.0/go.mod h1:9KTHXmSnoGruLpwFjVSX0lNNA75CykiMECbovNTZqGI=
|
||||
golang.org/x/sys v0.37.0 h1:fdNQudmxPjkdUTPnLn5mdQv7Zwvbvpaxqs831goi9kQ=
|
||||
golang.org/x/sys v0.37.0/go.mod h1:OgkHotnGiDImocRcuBABYBEXf8A9a87e/uXjp9XT3ks=
|
||||
golang.org/x/telemetry v0.0.0-20251008203120-078029d740a8 h1:LvzTn0GQhWuvKH/kVRS3R3bVAsdQWI7hvfLHGgh9+lU=
|
||||
golang.org/x/telemetry v0.0.0-20251008203120-078029d740a8/go.mod h1:Pi4ztBfryZoJEkyFTI5/Ocsu2jXyDr6iSdgJiYE/uwE=
|
||||
golang.org/x/mod v0.30.1-0.20251114215501-3f03020ad526 h1:LPpBM4CGUFMC47OqgAr2YIUxEUjH1Ur+D3KR/1LiuuQ=
|
||||
golang.org/x/mod v0.30.1-0.20251114215501-3f03020ad526/go.mod h1:lAsf5O2EvJeSFMiBxXDki7sCgAxEUcZHXoXMKT4GJKc=
|
||||
golang.org/x/sync v0.18.0 h1:kr88TuHDroi+UVf+0hZnirlk8o8T+4MrK6mr60WkH/I=
|
||||
golang.org/x/sync v0.18.0/go.mod h1:9KTHXmSnoGruLpwFjVSX0lNNA75CykiMECbovNTZqGI=
|
||||
golang.org/x/sys v0.38.0 h1:3yZWxaJjBmCWXqhN1qh02AkOnCQ1poK6oF+a7xWL6Gc=
|
||||
golang.org/x/sys v0.38.0/go.mod h1:OgkHotnGiDImocRcuBABYBEXf8A9a87e/uXjp9XT3ks=
|
||||
golang.org/x/telemetry v0.0.0-20251111182119-bc8e575c7b54 h1:E2/AqCUMZGgd73TQkxUMcMla25GB9i/5HOdLr+uH7Vo=
|
||||
golang.org/x/telemetry v0.0.0-20251111182119-bc8e575c7b54/go.mod h1:hKdjCMrbv9skySur+Nek8Hd0uJ0GuxJIoIX2payrIdQ=
|
||||
golang.org/x/term v0.34.0 h1:O/2T7POpk0ZZ7MAzMeWFSg6S5IpWd/RXDlM9hgM3DR4=
|
||||
golang.org/x/term v0.34.0/go.mod h1:5jC53AEywhIVebHgPVeg0mj8OD3VO9OzclacVrqpaAw=
|
||||
golang.org/x/text v0.30.0 h1:yznKA/E9zq54KzlzBEAWn1NXSQ8DIp/NYMy88xJjl4k=
|
||||
golang.org/x/text v0.30.0/go.mod h1:yDdHFIX9t+tORqspjENWgzaCVXgk0yYnYuSZ8UzzBVM=
|
||||
golang.org/x/tools v0.38.1-0.20251015192825-7d9453ccc0f5 h1:cz7f45KGWAtyIrz6bm45Gc+lw8beIxBSW3EQh4Bwbg4=
|
||||
golang.org/x/tools v0.38.1-0.20251015192825-7d9453ccc0f5/go.mod h1:yEsQ/d/YK8cjh0L6rZlY8tgtlKiBNTL14pGDJPJpYQs=
|
||||
golang.org/x/tools v0.39.1-0.20251114194111-59ff18ce4883 h1:aeO0AW8d+a+5+hNQx9f4J5egD89zftrY2x42KGQjLzI=
|
||||
golang.org/x/tools v0.39.1-0.20251114194111-59ff18ce4883/go.mod h1:JnefbkDPyD8UU2kI5fuf8ZX4/yUeh9W877ZeBONxUqQ=
|
||||
rsc.io/markdown v0.0.0-20240306144322-0bf8f97ee8ef h1:mqLYrXCXYEZOop9/Dbo6RPX11539nwiCNBb1icVPmw8=
|
||||
rsc.io/markdown v0.0.0-20240306144322-0bf8f97ee8ef/go.mod h1:8xcPgWmwlZONN1D9bjxtHEjrUtSEa3fakVF8iaewYKQ=
|
||||
|
|
|
|||
3
src/cmd/go/internal/cache/hash.go
vendored
3
src/cmd/go/internal/cache/hash.go
vendored
|
|
@ -51,6 +51,9 @@ func stripExperiment(version string) string {
|
|||
if i := strings.Index(version, " X:"); i >= 0 {
|
||||
return version[:i]
|
||||
}
|
||||
if i := strings.Index(version, "-X:"); i >= 0 {
|
||||
return version[:i]
|
||||
}
|
||||
return version
|
||||
}
|
||||
|
||||
|
|
|
|||
|
|
@ -44,7 +44,7 @@ func newScriptEngine() *script.Engine {
|
|||
return script.OnceCondition(summary, func() (bool, error) { return f(), nil })
|
||||
}
|
||||
add("bzr", lazyBool("the 'bzr' executable exists and provides the standard CLI", hasWorkingBzr))
|
||||
add("git-min-vers", script.PrefixCondition("<suffix> indicates a minimum git version", hasAtLeastGitVersion))
|
||||
add("git-sha256", script.OnceCondition("the local 'git' version is recent enough to support sha256 object/commit hashes", gitSupportsSHA256))
|
||||
|
||||
interrupt := func(cmd *exec.Cmd) error { return cmd.Process.Signal(os.Interrupt) }
|
||||
gracePeriod := 30 * time.Second // arbitrary
|
||||
|
|
@ -412,10 +412,14 @@ func gitVersion() (string, error) {
|
|||
return "v" + string(matches[1]), nil
|
||||
}
|
||||
|
||||
func hasAtLeastGitVersion(s *script.State, minVers string) (bool, error) {
|
||||
func hasAtLeastGitVersion(minVers string) (bool, error) {
|
||||
gitVers, gitVersErr := gitVersion()
|
||||
if gitVersErr != nil {
|
||||
return false, gitVersErr
|
||||
}
|
||||
return semver.Compare(minVers, gitVers) <= 0, nil
|
||||
}
|
||||
|
||||
func gitSupportsSHA256() (bool, error) {
|
||||
return hasAtLeastGitVersion("v2.29")
|
||||
}
|
||||
|
|
|
|||
|
|
@ -44,7 +44,7 @@ func scriptConditions(t *testing.T) map[string]script.Cond {
|
|||
add("case-sensitive", script.OnceCondition("$WORK filesystem is case-sensitive", isCaseSensitive))
|
||||
add("cc", script.PrefixCondition("go env CC = <suffix> (ignoring the go/env file)", ccIs))
|
||||
add("git", lazyBool("the 'git' executable exists and provides the standard CLI", hasWorkingGit))
|
||||
add("git-min-vers", script.PrefixCondition("<suffix> indicates a minimum git version", hasAtLeastGitVersion))
|
||||
add("git-sha256", script.OnceCondition("the local 'git' version is recent enough to support sha256 object/commit hashes", gitSupportsSHA256))
|
||||
add("net", script.PrefixCondition("can connect to external network host <suffix>", hasNet))
|
||||
add("trimpath", script.OnceCondition("test binary was built with -trimpath", isTrimpath))
|
||||
|
||||
|
|
@ -171,7 +171,7 @@ func gitVersion() (string, error) {
|
|||
return "v" + string(matches[1]), nil
|
||||
}
|
||||
|
||||
func hasAtLeastGitVersion(s *script.State, minVers string) (bool, error) {
|
||||
func hasAtLeastGitVersion(minVers string) (bool, error) {
|
||||
gitVers, gitVersErr := gitVersion()
|
||||
if gitVersErr != nil {
|
||||
return false, gitVersErr
|
||||
|
|
@ -179,6 +179,10 @@ func hasAtLeastGitVersion(s *script.State, minVers string) (bool, error) {
|
|||
return semver.Compare(minVers, gitVers) <= 0, nil
|
||||
}
|
||||
|
||||
func gitSupportsSHA256() (bool, error) {
|
||||
return hasAtLeastGitVersion("v2.29")
|
||||
}
|
||||
|
||||
func hasWorkingBzr() bool {
|
||||
bzr, err := exec.LookPath("bzr")
|
||||
if err != nil {
|
||||
|
|
|
|||
4
src/cmd/go/testdata/script/README
vendored
4
src/cmd/go/testdata/script/README
vendored
|
|
@ -399,8 +399,8 @@ The available conditions are:
|
|||
GOOS/GOARCH supports -fuzz with instrumentation
|
||||
[git]
|
||||
the 'git' executable exists and provides the standard CLI
|
||||
[git-min-vers:*]
|
||||
<suffix> indicates a minimum git version
|
||||
[git-sha256]
|
||||
the local 'git' version is recent enough to support sha256 object/commit hashes
|
||||
[go-builder]
|
||||
GO_BUILDER_NAME is non-empty
|
||||
[link]
|
||||
|
|
|
|||
|
|
@ -1,6 +1,6 @@
|
|||
[short] skip
|
||||
[!git] skip
|
||||
[!git-min-vers:v2.29] skip
|
||||
[!git-sha256] skip
|
||||
|
||||
env GOPRIVATE=vcs-test.golang.org
|
||||
|
||||
|
|
|
|||
|
|
@ -1,6 +1,6 @@
|
|||
[short] skip
|
||||
[!git] skip
|
||||
[!git-min-vers:v2.29] skip
|
||||
[!git-sha256] skip
|
||||
|
||||
env GOPRIVATE=vcs-test.golang.org
|
||||
|
||||
|
|
|
|||
|
|
@ -1,6 +1,6 @@
|
|||
[short] skip
|
||||
[!git] skip
|
||||
[!git-min-vers:v2.29] skip
|
||||
[!git-sha256] skip
|
||||
|
||||
# This is a git sha256-mode copy of mod_download_git_bareRepository
|
||||
|
||||
|
|
|
|||
|
|
@ -2,14 +2,14 @@
|
|||
# 'GOPROXY=direct go get golang.org/x/tools/gopls@master' did not correctly
|
||||
# resolve the pseudo-version for its dependency on golang.org/x/tools.
|
||||
|
||||
[!net:cloud.google.com] skip
|
||||
[short] skip
|
||||
[!git] skip
|
||||
|
||||
env GO111MODULE=on
|
||||
env GOPROXY=direct
|
||||
env GOSUMDB=off
|
||||
|
||||
go list -m cloud.google.com/go@main
|
||||
go list -m vcs-test.golang.org/git/tagtests.git@master
|
||||
! stdout 'v0.0.0-'
|
||||
|
||||
-- go.mod --
|
||||
|
|
|
|||
|
|
@ -1,4 +1,4 @@
|
|||
[!git-min-vers:v2.29] skip
|
||||
[!git-sha256] skip
|
||||
|
||||
handle git
|
||||
|
||||
|
|
|
|||
|
|
@ -1153,36 +1153,37 @@ type Func interface {
|
|||
// Link holds the context for writing object code from a compiler
|
||||
// to be linker input or for reading that input into the linker.
|
||||
type Link struct {
|
||||
Headtype objabi.HeadType
|
||||
Arch *LinkArch
|
||||
Debugasm int
|
||||
Debugvlog bool
|
||||
Debugpcln string
|
||||
Flag_shared bool
|
||||
Flag_dynlink bool
|
||||
Flag_linkshared bool
|
||||
Flag_optimize bool
|
||||
Flag_locationlists bool
|
||||
Flag_noRefName bool // do not include referenced symbol names in object file
|
||||
Retpoline bool // emit use of retpoline stubs for indirect jmp/call
|
||||
Flag_maymorestack string // If not "", call this function before stack checks
|
||||
Bso *bufio.Writer
|
||||
Pathname string
|
||||
Pkgpath string // the current package's import path
|
||||
hashmu sync.Mutex // protects hash, funchash
|
||||
hash map[string]*LSym // name -> sym mapping
|
||||
funchash map[string]*LSym // name -> sym mapping for ABIInternal syms
|
||||
statichash map[string]*LSym // name -> sym mapping for static syms
|
||||
PosTable src.PosTable
|
||||
InlTree InlTree // global inlining tree used by gc/inl.go
|
||||
DwFixups *DwarfFixupTable
|
||||
DwTextCount int
|
||||
Imports []goobj.ImportedPkg
|
||||
DiagFunc func(string, ...any)
|
||||
DiagFlush func()
|
||||
DebugInfo func(ctxt *Link, fn *LSym, info *LSym, curfn Func) ([]dwarf.Scope, dwarf.InlCalls)
|
||||
GenAbstractFunc func(fn *LSym)
|
||||
Errors int
|
||||
Headtype objabi.HeadType
|
||||
Arch *LinkArch
|
||||
CompressInstructions bool // use compressed instructions where possible (if supported by architecture)
|
||||
Debugasm int
|
||||
Debugvlog bool
|
||||
Debugpcln string
|
||||
Flag_shared bool
|
||||
Flag_dynlink bool
|
||||
Flag_linkshared bool
|
||||
Flag_optimize bool
|
||||
Flag_locationlists bool
|
||||
Flag_noRefName bool // do not include referenced symbol names in object file
|
||||
Retpoline bool // emit use of retpoline stubs for indirect jmp/call
|
||||
Flag_maymorestack string // If not "", call this function before stack checks
|
||||
Bso *bufio.Writer
|
||||
Pathname string
|
||||
Pkgpath string // the current package's import path
|
||||
hashmu sync.Mutex // protects hash, funchash
|
||||
hash map[string]*LSym // name -> sym mapping
|
||||
funchash map[string]*LSym // name -> sym mapping for ABIInternal syms
|
||||
statichash map[string]*LSym // name -> sym mapping for static syms
|
||||
PosTable src.PosTable
|
||||
InlTree InlTree // global inlining tree used by gc/inl.go
|
||||
DwFixups *DwarfFixupTable
|
||||
DwTextCount int
|
||||
Imports []goobj.ImportedPkg
|
||||
DiagFunc func(string, ...any)
|
||||
DiagFlush func()
|
||||
DebugInfo func(ctxt *Link, fn *LSym, info *LSym, curfn Func) ([]dwarf.Scope, dwarf.InlCalls)
|
||||
GenAbstractFunc func(fn *LSym)
|
||||
Errors int
|
||||
|
||||
InParallel bool // parallel backend phase in effect
|
||||
UseBASEntries bool // use Base Address Selection Entries in location lists and PC ranges
|
||||
|
|
|
|||
|
|
@ -589,6 +589,10 @@ const (
|
|||
AORN
|
||||
AANDN
|
||||
|
||||
// 2.2.1.12
|
||||
AMULWVW
|
||||
AMULWVWU
|
||||
|
||||
// 2.2.7. Atomic Memory Access Instructions
|
||||
AAMSWAPB
|
||||
AAMSWAPH
|
||||
|
|
|
|||
|
|
@ -131,6 +131,8 @@ var Anames = []string{
|
|||
"ALSLV",
|
||||
"ORN",
|
||||
"ANDN",
|
||||
"MULWVW",
|
||||
"MULWVWU",
|
||||
"AMSWAPB",
|
||||
"AMSWAPH",
|
||||
"AMSWAPW",
|
||||
|
|
|
|||
|
|
@ -1503,6 +1503,8 @@ func buildop(ctxt *obj.Link) {
|
|||
opset(AREMU, r0)
|
||||
opset(ADIV, r0)
|
||||
opset(ADIVU, r0)
|
||||
opset(AMULWVW, r0)
|
||||
opset(AMULWVWU, r0)
|
||||
|
||||
case AMULV:
|
||||
opset(AMULVU, r0)
|
||||
|
|
@ -3230,6 +3232,10 @@ func (c *ctxt0) oprrr(a obj.As) uint32 {
|
|||
return 0x3c << 15 // mulh.d
|
||||
case AMULHVU:
|
||||
return 0x3d << 15 // mulhu.d
|
||||
case AMULWVW:
|
||||
return 0x3e << 15 // mulw.d.w
|
||||
case AMULWVWU:
|
||||
return 0x3f << 15 // mulw.d.wu
|
||||
case ADIV:
|
||||
return 0x40 << 15 // div.w
|
||||
case ADIVU:
|
||||
|
|
|
|||
|
|
@ -11,8 +11,8 @@ import (
|
|||
"os"
|
||||
"os/exec"
|
||||
"path/filepath"
|
||||
"regexp"
|
||||
"runtime"
|
||||
"strings"
|
||||
"testing"
|
||||
)
|
||||
|
||||
|
|
@ -48,10 +48,10 @@ func genLargeBranch(buf *bytes.Buffer) {
|
|||
fmt.Fprintln(buf, "TEXT f(SB),0,$0-0")
|
||||
fmt.Fprintln(buf, "BEQ X0, X0, label")
|
||||
for i := 0; i < 1<<19; i++ {
|
||||
fmt.Fprintln(buf, "ADD $0, X0, X0")
|
||||
fmt.Fprintln(buf, "ADD $0, X5, X0")
|
||||
}
|
||||
fmt.Fprintln(buf, "label:")
|
||||
fmt.Fprintln(buf, "ADD $0, X0, X0")
|
||||
fmt.Fprintln(buf, "ADD $0, X5, X0")
|
||||
}
|
||||
|
||||
// TestLargeCall generates a large function (>1MB of text) with a call to
|
||||
|
|
@ -112,11 +112,11 @@ func genLargeCall(buf *bytes.Buffer) {
|
|||
fmt.Fprintln(buf, "TEXT ·x(SB),0,$0-0")
|
||||
fmt.Fprintln(buf, "CALL ·y(SB)")
|
||||
for i := 0; i < 1<<19; i++ {
|
||||
fmt.Fprintln(buf, "ADD $0, X0, X0")
|
||||
fmt.Fprintln(buf, "ADD $0, X5, X0")
|
||||
}
|
||||
fmt.Fprintln(buf, "RET")
|
||||
fmt.Fprintln(buf, "TEXT ·y(SB),0,$0-0")
|
||||
fmt.Fprintln(buf, "ADD $0, X0, X0")
|
||||
fmt.Fprintln(buf, "ADD $0, X5, X0")
|
||||
fmt.Fprintln(buf, "RET")
|
||||
}
|
||||
|
||||
|
|
@ -301,9 +301,9 @@ TEXT _stub(SB),$0-0
|
|||
// FENCE
|
||||
// NOP
|
||||
// FENCE
|
||||
// RET
|
||||
want := "0f 00 f0 0f 13 00 00 00 0f 00 f0 0f 67 80 00 00"
|
||||
if !strings.Contains(string(out), want) {
|
||||
// RET (CJALR or JALR)
|
||||
want := regexp.MustCompile("0x0000 0f 00 f0 0f 13 00 00 00 0f 00 f0 0f (82 80|67 80 00 00) ")
|
||||
if !want.Match(out) {
|
||||
t.Errorf("PCALIGN test failed - got %s\nwant %s", out, want)
|
||||
}
|
||||
}
|
||||
|
|
|
|||
|
|
@ -326,6 +326,9 @@ const (
|
|||
NEED_GOT_PCREL_ITYPE_RELOC
|
||||
)
|
||||
|
||||
const NEED_RELOC = NEED_JAL_RELOC | NEED_CALL_RELOC | NEED_PCREL_ITYPE_RELOC |
|
||||
NEED_PCREL_STYPE_RELOC | NEED_GOT_PCREL_ITYPE_RELOC
|
||||
|
||||
// RISC-V mnemonics, as defined in the "opcodes" and "opcodes-pseudo" files
|
||||
// at https://github.com/riscv/riscv-opcodes.
|
||||
//
|
||||
|
|
|
|||
297
src/cmd/internal/obj/riscv/doc.go
Normal file
297
src/cmd/internal/obj/riscv/doc.go
Normal file
|
|
@ -0,0 +1,297 @@
|
|||
// Copyright 2025 The Go Authors. All rights reserved.
|
||||
// Use of this source code is governed by a BSD-style
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
/*
|
||||
Package riscv implements the riscv64 assembler.
|
||||
|
||||
# Register naming
|
||||
|
||||
The integer registers are named X0 through to X31, however X4 must be accessed
|
||||
through its RISC-V ABI name, TP, and X27, which holds a pointer to the Go
|
||||
routine structure, must be referred to as g. Additionally, when building in
|
||||
shared mode, X3 is unavailable and must be accessed via its RISC-V ABI name,
|
||||
GP.
|
||||
|
||||
The floating-point registers are named F0 through to F31.
|
||||
|
||||
The vector registers are named V0 through to V31.
|
||||
|
||||
Both integer and floating-point registers can be referred to by their RISC-V
|
||||
ABI names, e.g., A0 or FT0, with the exception that X27 cannot be referred to
|
||||
by its RISC-V ABI name, S11. It must be referred to as g.
|
||||
|
||||
Some of the integer registers are used by the Go runtime and assembler - X26 is
|
||||
the closure pointer, X27 points to the Go routine structure and X31 is a
|
||||
temporary register used by the Go assembler. Use of X31 should be avoided in
|
||||
hand written assembly code as its value could be altered by the instruction
|
||||
sequences emitted by the assembler.
|
||||
|
||||
# Instruction naming
|
||||
|
||||
Many RISC-V instructions contain one or more suffixes in their names. In the
|
||||
[RISC-V ISA Manual] these suffixes are separated from themselves and the
|
||||
name of the instruction mnemonic with a dot ('.'). In the Go assembler, the
|
||||
separators are omitted and the suffixes are written in upper case.
|
||||
|
||||
Example:
|
||||
|
||||
FMVWX <=> fmv.w.x
|
||||
|
||||
# Rounding modes
|
||||
|
||||
The Go toolchain does not set the FCSR register and requires the desired
|
||||
rounding mode to be explicitly encoded within floating-point instructions.
|
||||
The syntax the Go assembler uses to specify the rounding modes differs
|
||||
from the syntax in the RISC-V specifications. In the [RISC-V ISA Manual]
|
||||
the rounding mode is given as an extra operand at the end of an
|
||||
assembly language instruction. In the Go assembler, the rounding modes are
|
||||
converted to uppercase and follow the instruction mnemonic from which they
|
||||
are separated with a dot ('.').
|
||||
|
||||
Example:
|
||||
|
||||
FCVTLUS.RNE F0, X5 <=> fcvt.lu.s x5, f0, rne
|
||||
|
||||
RTZ is assumed if the rounding mode is omitted.
|
||||
|
||||
# RISC-V extensions
|
||||
|
||||
By default the Go compiler targets the [rva20u64] profile. This profile mandates
|
||||
all the general RISC-V instructions, allowing Go to use integer, multiplication,
|
||||
division, floating-point and atomic instructions without having to
|
||||
perform compile time or runtime checks to verify that their use is appropriate
|
||||
for the target hardware. All widely available riscv64 devices support at least
|
||||
[rva20u64]. The Go toolchain can be instructed to target later RISC-V profiles,
|
||||
including, [rva22u64] and [rva23u64], via the GORISCV64 environment variable.
|
||||
Instructions that are provided by newer profiles cannot typically be used in
|
||||
handwritten assembly code without compile time guards (or runtime checks)
|
||||
that ensure they are hardware supported.
|
||||
|
||||
The file asm_riscv64.h defines macros for each RISC-V extension that is enabled
|
||||
by setting the GORISCV64 environment variable to a value other than [rva20u64].
|
||||
For example, if GORISCV64=rva22u64 the macros hasZba, hasZbb and hasZbs will be
|
||||
defined. If GORISCV64=rva23u64 hasV will be defined in addition to hasZba,
|
||||
hasZbb and hasZbs. These macros can be used to determine whether it's safe
|
||||
to use an instruction in hand-written assembly.
|
||||
|
||||
It is not always necessary to include asm_riscv64.h and use #ifdefs in your
|
||||
code to safely take advantage of instructions present in the [rva22u64]
|
||||
profile. In some cases the assembler can generate [rva20u64] compatible code
|
||||
even when an [rva22u64] instruction is used in an assembly source file. When
|
||||
GORISCV64=rva20u64 the assembler will synthesize certain [rva22u64]
|
||||
instructions, e.g., ANDN, using multiple [rva20u64] instructions. Instructions
|
||||
such as ANDN can then be freely used in assembly code without checking to see
|
||||
whether the instruction is supported by the target profile. When building a
|
||||
source file containing the ANDN instruction with GORISCV64=rva22u64 the
|
||||
assembler will emit the Zbb ANDN instruction directly. When building the same
|
||||
source file with GORISCV64=rva20u64 the assembler will emit multiple [rva20u64]
|
||||
instructions to synthesize ANDN.
|
||||
|
||||
The assembler will also use [rva22u64] instructions to implement the zero and
|
||||
sign extension instructions, e.g., MOVB and MOVHU, when GORISCV64=rva22u64 or
|
||||
greater.
|
||||
|
||||
The instructions not implemented in the default profile ([rva20u64]) that can
|
||||
be safely used in assembly code without compile time checks are:
|
||||
|
||||
- ANDN
|
||||
- MAX
|
||||
- MAXU
|
||||
- MIN
|
||||
- MINU
|
||||
- MOVB
|
||||
- MOVH
|
||||
- MOVHU
|
||||
- MOVWU
|
||||
- ORN
|
||||
- ROL
|
||||
- ROLW
|
||||
- ROR
|
||||
- RORI
|
||||
- RORIW
|
||||
- RORW
|
||||
- XNOR
|
||||
|
||||
# Operand ordering
|
||||
|
||||
The ordering used for instruction operands in the Go assembler differs from the
|
||||
ordering defined in the [RISC-V ISA Manual].
|
||||
|
||||
1. R-Type instructions
|
||||
|
||||
R-Type instructions are written in the reverse order to that given in the
|
||||
[RISC-V ISA Manual], with the register order being rs2, rs1, rd.
|
||||
|
||||
Examples:
|
||||
|
||||
ADD X10, X11, X12 <=> add x12, x11, x10
|
||||
FADDD F10, F11, F12 <=> fadd.d f12, f11, f10
|
||||
|
||||
2. I-Type arithmetic instructions
|
||||
|
||||
I-Type arithmetic instructions (not loads, fences, ebreak, ecall) use the same
|
||||
ordering as the R-Type instructions, typically, imm12, rs1, rd.
|
||||
|
||||
Examples:
|
||||
|
||||
ADDI $1, X11, X12 <=> add x12, x11, 1
|
||||
SLTI $1, X11, X12 <=> slti x12, x11, 1
|
||||
|
||||
3. Loads and Stores
|
||||
|
||||
Load instructions are written with the source operand (whether it be a register
|
||||
or a memory address), first followed by the destination operand.
|
||||
|
||||
Examples:
|
||||
|
||||
MOV 16(X2), X10 <=> ld x10, 16(x2)
|
||||
MOV X10, (X2) <=> sd x10, 0(x2)
|
||||
|
||||
4. Branch instructions
|
||||
|
||||
The branch instructions use the same operand ordering as is given in the
|
||||
[RISC-V ISA Manual], e.g., rs1, rs2, label.
|
||||
|
||||
Example:
|
||||
|
||||
BLT X12, X23, loop1 <=> blt x12, x23, loop1
|
||||
|
||||
BLT X12, X23, label will jump to label if X12 < X23. Note this is not the
|
||||
same ordering as is used for the SLT instructions.
|
||||
|
||||
5. FMA instructions
|
||||
|
||||
The Go assembler uses a different ordering for the RISC-V FMA operands to
|
||||
the ordering given in the [RISC-V ISA Manual]. The operands are rotated one
|
||||
place to the left, so that the destination operand comes last.
|
||||
|
||||
Example:
|
||||
|
||||
FMADDS F1, F2, F3, F4 <=> fmadd.s f4, f1, f2, f3
|
||||
|
||||
6. AMO instructions
|
||||
|
||||
The ordering used for the AMO operations is rs2, rs1, rd, i.e., the operands
|
||||
as specified in the [RISC-V ISA Manual] are rotated one place to the left.
|
||||
|
||||
Example:
|
||||
|
||||
AMOSWAPW X5, (X6), X7 <=> amoswap.w x7, x5, (x6)
|
||||
|
||||
7. Vector instructions
|
||||
|
||||
The VSETVLI instruction uses the same symbolic names as the [RISC-V ISA Manual]
|
||||
to represent the components of vtype, with the exception
|
||||
that they are written in upper case. The ordering of the operands in the Go
|
||||
assembler differs from the [RISC-V ISA Manual] in that the operands are
|
||||
rotated one place to the left so that the destination register, the register
|
||||
that holds the new vl, is the last operand.
|
||||
|
||||
Example:
|
||||
|
||||
VSETVLI X10, E8, M1, TU, MU, X12 <=> vsetvli x12, x10, e8, m1, tu, mu
|
||||
|
||||
Vector load and store instructions follow the pattern set by scalar loads and
|
||||
stores, i.e., the source is always the first operand and the destination the
|
||||
last. However, the ordering of the operands of these instructions is
|
||||
complicated by the optional mask register and, in some cases, the use of an
|
||||
additional stride or index register. In the Go assembler the index and stride
|
||||
registers appear as the second operand in indexed or strided loads and stores,
|
||||
while the mask register, if present, is always the penultimate operand.
|
||||
|
||||
Examples:
|
||||
|
||||
VLE8V (X10), V3 <=> vle8.v v3, (x10)
|
||||
VSE8V V3, (X10) <=> vse8.v v3, (x10)
|
||||
VLE8V (X10), V0, V3 <=> vle8.v v3, (x10), v0.t
|
||||
VSE8V V3, V0, (X10) <=> vse8.v v3, (x10), v0.t
|
||||
VLSE8V (X10), X11, V3 <=> vlse8.v v3, (x10), x11
|
||||
VSSE8V V3, X11, (X10) <=> vsse8.v v3, (x10), x11
|
||||
VLSE8V (X10), X11, V0, V3 <=> vlse8.v v3, (x10), x11, v0.t
|
||||
VSSE8V V3, X11, V0, (X10) <=> vsse8.v v3, (x10), x11, v0.t
|
||||
VLUXEI8V (X10), V2, V3 <=> vluxei8.v v3, (x10), v2
|
||||
VSUXEI8V V3, V2, (X10) <=> vsuxei8.v v3, (x10), v2
|
||||
VLUXEI8V (X10), V2, V0, V3 <=> vluxei8.v v3, (x10), v2, v0.t
|
||||
VSUXEI8V V3, V2, V0, (X10) <=> vsuxei8.v v3, (x10), v2, v0.t
|
||||
VL1RE8V (X10), V3 <=> vl1re8.v v3, (x10)
|
||||
VS1RV V3, (X11) <=> vs1r.v v3, (x11)
|
||||
|
||||
The ordering of operands for two and three argument vector arithmetic instructions is
|
||||
reversed in the Go assembler.
|
||||
|
||||
Examples:
|
||||
|
||||
VMVVV V2, V3 <=> vmv.v.v v3, v2
|
||||
VADDVV V1, V2, V3 <=> vadd.vv v3, v2, v1
|
||||
VADDVX X10, V2, V3 <=> vadd.vx v3, v2, x10
|
||||
VMADCVI $15, V2, V3 <=> vmadc.vi v3, v2, 15
|
||||
|
||||
The mask register, when specified, is always the penultimate operand in a vector
|
||||
arithmetic instruction, appearing before the destination register.
|
||||
|
||||
Examples:
|
||||
|
||||
VANDVV V1, V2, V0, V3 <=> vand.vv v3, v2, v1, v0.t
|
||||
|
||||
# Ternary instructions
|
||||
|
||||
The Go assembler allows the second operand to be omitted from most ternary
|
||||
instructions if it matches the third (destination) operand.
|
||||
|
||||
Examples:
|
||||
|
||||
ADD X10, X12, X12 <=> ADD X10, X12
|
||||
ANDI $3, X12, X12 <=> ANDI $3, X12
|
||||
|
||||
The use of this abbreviated syntax is encouraged.
|
||||
|
||||
# Ordering of atomic instructions
|
||||
|
||||
It is not possible to specify the ordering bits in the FENCE, LR, SC or AMO
|
||||
instructions. The FENCE instruction is always emitted as a full fence, the
|
||||
acquire and release bits are always set for the AMO instructions, the acquire
|
||||
bit is always set for the LR instructions while the release bit is set for
|
||||
the SC instructions.
|
||||
|
||||
# Immediate operands
|
||||
|
||||
In many cases, where an R-Type instruction has a corresponding I-Type
|
||||
instruction, the R-Type mnemonic can be used in place of the I-Type mnemonic.
|
||||
The assembler assumes that the immediate form of the instruction was intended
|
||||
when the first operand is given as an immediate value rather than a register.
|
||||
|
||||
Example:
|
||||
|
||||
AND $3, X12, X13 <=> ANDI $3, X12, X13
|
||||
|
||||
# Integer constant materialization
|
||||
|
||||
The MOV instruction can be used to set a register to the value of any 64 bit
|
||||
constant literal. The way this is achieved by the assembler varies depending
|
||||
on the value of the constant. Where possible the assembler will synthesize the
|
||||
constant using one or more RISC-V arithmetic instructions. If it is unable
|
||||
to easily materialize the constant it will load the 64 bit literal from memory.
|
||||
|
||||
A 32 bit constant literal can be specified as an argument to ADDI, ANDI, ORI and
|
||||
XORI. If the specified literal does not fit into 12 bits the assembler will
|
||||
generate extra instructions to synthesize it.
|
||||
|
||||
Integer constants provided as operands to all other instructions must fit into
|
||||
the number of bits allowed by the instructions' encodings for immediate values.
|
||||
Otherwise, an error will be generated.
|
||||
|
||||
# Floating point constant materialization
|
||||
|
||||
The MOVF and MOVD instructions can be used to set a register to the value
|
||||
of any 32 bit or 64 bit floating point constant literal, respectively. Unless
|
||||
the constant literal is 0.0, MOVF and MOVD will be encoded as FLW and FLD
|
||||
instructions that load the constant from a location within the program's
|
||||
binary.
|
||||
|
||||
[RISC-V ISA Manual]: https://github.com/riscv/riscv-isa-manual
|
||||
[rva20u64]: https://github.com/riscv/riscv-profiles/blob/main/src/profiles.adoc#51-rva20u64-profile
|
||||
[rva22u64]: https://github.com/riscv/riscv-profiles/blob/main/src/profiles.adoc#rva22u64-profile
|
||||
[rva23u64]: https://github.com/riscv/riscv-profiles/blob/main/src/rva23-profile.adoc#rva23u64-profile
|
||||
*/
|
||||
package riscv
|
||||
|
|
@ -414,10 +414,10 @@ func containsCall(sym *obj.LSym) bool {
|
|||
|
||||
// setPCs sets the Pc field in all instructions reachable from p.
|
||||
// It uses pc as the initial value and returns the next available pc.
|
||||
func setPCs(p *obj.Prog, pc int64) int64 {
|
||||
func setPCs(p *obj.Prog, pc int64, compress bool) int64 {
|
||||
for ; p != nil; p = p.Link {
|
||||
p.Pc = pc
|
||||
for _, ins := range instructionsForProg(p) {
|
||||
for _, ins := range instructionsForProg(p, compress) {
|
||||
pc += int64(ins.length())
|
||||
}
|
||||
|
||||
|
|
@ -671,7 +671,7 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) {
|
|||
// a fixed point will be reached). No attempt to handle functions > 2GiB.
|
||||
for {
|
||||
big, rescan := false, false
|
||||
maxPC := setPCs(cursym.Func().Text, 0)
|
||||
maxPC := setPCs(cursym.Func().Text, 0, ctxt.CompressInstructions)
|
||||
if maxPC+maxTrampSize > (1 << 20) {
|
||||
big = true
|
||||
}
|
||||
|
|
@ -801,7 +801,7 @@ func preprocess(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) {
|
|||
|
||||
// Validate all instructions - this provides nice error messages.
|
||||
for p := cursym.Func().Text; p != nil; p = p.Link {
|
||||
for _, ins := range instructionsForProg(p) {
|
||||
for _, ins := range instructionsForProg(p, ctxt.CompressInstructions) {
|
||||
ins.validate(ctxt)
|
||||
}
|
||||
}
|
||||
|
|
@ -1141,6 +1141,14 @@ func wantImmU(ctxt *obj.Link, ins *instruction, imm int64, nbits uint) {
|
|||
}
|
||||
}
|
||||
|
||||
func isScaledImmI(imm int64, nbits uint, scale int64) bool {
|
||||
return immFits(imm, nbits, true) == nil && imm%scale == 0
|
||||
}
|
||||
|
||||
func isScaledImmU(imm int64, nbits uint, scale int64) bool {
|
||||
return immFits(imm, nbits, false) == nil && imm%scale == 0
|
||||
}
|
||||
|
||||
func wantScaledImm(ctxt *obj.Link, ins *instruction, imm int64, nbits uint, scale int64, signed bool) {
|
||||
if err := immFits(imm, nbits, signed); err != nil {
|
||||
ctxt.Diag("%v: %v", ins, err)
|
||||
|
|
@ -1180,6 +1188,10 @@ func wantIntReg(ctxt *obj.Link, ins *instruction, pos string, r uint32) {
|
|||
wantReg(ctxt, ins, pos, "integer", r, REG_X0, REG_X31)
|
||||
}
|
||||
|
||||
func isIntPrimeReg(r uint32) bool {
|
||||
return r >= REG_X8 && r <= REG_X15
|
||||
}
|
||||
|
||||
// wantIntPrimeReg checks that r is an integer register that can be used
|
||||
// in a prime register field of a compressed instruction.
|
||||
func wantIntPrimeReg(ctxt *obj.Link, ins *instruction, pos string, r uint32) {
|
||||
|
|
@ -1191,6 +1203,10 @@ func wantFloatReg(ctxt *obj.Link, ins *instruction, pos string, r uint32) {
|
|||
wantReg(ctxt, ins, pos, "float", r, REG_F0, REG_F31)
|
||||
}
|
||||
|
||||
func isFloatPrimeReg(r uint32) bool {
|
||||
return r >= REG_F8 && r <= REG_F15
|
||||
}
|
||||
|
||||
// wantFloatPrimeReg checks that r is an floating-point register that can
|
||||
// be used in a prime register field of a compressed instruction.
|
||||
func wantFloatPrimeReg(ctxt *obj.Link, ins *instruction, pos string, r uint32) {
|
||||
|
|
@ -3515,6 +3531,147 @@ func (ins *instruction) usesRegTmp() bool {
|
|||
return ins.rd == REG_TMP || ins.rs1 == REG_TMP || ins.rs2 == REG_TMP
|
||||
}
|
||||
|
||||
func (ins *instruction) compress() {
|
||||
switch ins.as {
|
||||
case ALW:
|
||||
if ins.rd != REG_X0 && ins.rs1 == REG_SP && isScaledImmU(ins.imm, 8, 4) {
|
||||
ins.as, ins.rs1, ins.rs2 = ACLWSP, obj.REG_NONE, ins.rs1
|
||||
} else if isIntPrimeReg(ins.rd) && isIntPrimeReg(ins.rs1) && isScaledImmU(ins.imm, 7, 4) {
|
||||
ins.as = ACLW
|
||||
}
|
||||
|
||||
case ALD:
|
||||
if ins.rs1 == REG_SP && ins.rd != REG_X0 && isScaledImmU(ins.imm, 9, 8) {
|
||||
ins.as, ins.rs1, ins.rs2 = ACLDSP, obj.REG_NONE, ins.rs1
|
||||
} else if isIntPrimeReg(ins.rd) && isIntPrimeReg(ins.rs1) && isScaledImmU(ins.imm, 8, 8) {
|
||||
ins.as = ACLD
|
||||
}
|
||||
|
||||
case AFLD:
|
||||
if ins.rs1 == REG_SP && isScaledImmU(ins.imm, 9, 8) {
|
||||
ins.as, ins.rs1, ins.rs2 = ACFLDSP, obj.REG_NONE, ins.rs1
|
||||
} else if isFloatPrimeReg(ins.rd) && isIntPrimeReg(ins.rs1) && isScaledImmU(ins.imm, 8, 8) {
|
||||
ins.as = ACFLD
|
||||
}
|
||||
|
||||
case ASW:
|
||||
if ins.rd == REG_SP && isScaledImmU(ins.imm, 8, 4) {
|
||||
ins.as, ins.rs1, ins.rs2 = ACSWSP, obj.REG_NONE, ins.rs1
|
||||
} else if isIntPrimeReg(ins.rd) && isIntPrimeReg(ins.rs1) && isScaledImmU(ins.imm, 7, 4) {
|
||||
ins.as, ins.rd, ins.rs1, ins.rs2 = ACSW, obj.REG_NONE, ins.rd, ins.rs1
|
||||
}
|
||||
|
||||
case ASD:
|
||||
if ins.rd == REG_SP && isScaledImmU(ins.imm, 9, 8) {
|
||||
ins.as, ins.rs1, ins.rs2 = ACSDSP, obj.REG_NONE, ins.rs1
|
||||
} else if isIntPrimeReg(ins.rd) && isIntPrimeReg(ins.rs1) && isScaledImmU(ins.imm, 8, 8) {
|
||||
ins.as, ins.rd, ins.rs1, ins.rs2 = ACSD, obj.REG_NONE, ins.rd, ins.rs1
|
||||
}
|
||||
|
||||
case AFSD:
|
||||
if ins.rd == REG_SP && isScaledImmU(ins.imm, 9, 8) {
|
||||
ins.as, ins.rs1, ins.rs2 = ACFSDSP, obj.REG_NONE, ins.rs1
|
||||
} else if isIntPrimeReg(ins.rd) && isFloatPrimeReg(ins.rs1) && isScaledImmU(ins.imm, 8, 8) {
|
||||
ins.as, ins.rd, ins.rs1, ins.rs2 = ACFSD, obj.REG_NONE, ins.rd, ins.rs1
|
||||
}
|
||||
|
||||
case AADDI:
|
||||
if ins.rd == REG_SP && ins.rs1 == REG_SP && ins.imm != 0 && isScaledImmI(ins.imm, 10, 16) {
|
||||
ins.as = ACADDI16SP
|
||||
} else if ins.rd != REG_X0 && ins.rd == ins.rs1 && ins.imm != 0 && immIFits(ins.imm, 6) == nil {
|
||||
ins.as = ACADDI
|
||||
} else if isIntPrimeReg(ins.rd) && ins.rs1 == REG_SP && ins.imm != 0 && isScaledImmU(ins.imm, 10, 4) {
|
||||
ins.as = ACADDI4SPN
|
||||
} else if ins.rd != REG_X0 && ins.rs1 == REG_X0 && immIFits(ins.imm, 6) == nil {
|
||||
ins.as, ins.rs1 = ACLI, obj.REG_NONE
|
||||
} else if ins.rd != REG_X0 && ins.rs1 != REG_X0 && ins.imm == 0 {
|
||||
ins.as, ins.rs1, ins.rs2 = ACMV, obj.REG_NONE, ins.rs1
|
||||
} else if ins.rd == REG_X0 && ins.rs1 == REG_X0 && ins.imm == 0 {
|
||||
ins.as, ins.rs1 = ACNOP, ins.rd
|
||||
}
|
||||
|
||||
case AADDIW:
|
||||
if ins.rd == ins.rs1 && immIFits(ins.imm, 6) == nil {
|
||||
ins.as = ACADDIW
|
||||
}
|
||||
|
||||
case ALUI:
|
||||
if ins.rd != REG_X0 && ins.rd != REG_SP && ins.imm != 0 && immIFits(ins.imm, 6) == nil {
|
||||
ins.as = ACLUI
|
||||
}
|
||||
|
||||
case ASLLI:
|
||||
if ins.rd != REG_X0 && ins.rd == ins.rs1 && ins.imm != 0 {
|
||||
ins.as = ACSLLI
|
||||
}
|
||||
|
||||
case ASRLI:
|
||||
if isIntPrimeReg(ins.rd) && ins.rd == ins.rs1 && ins.imm != 0 {
|
||||
ins.as = ACSRLI
|
||||
}
|
||||
|
||||
case ASRAI:
|
||||
if isIntPrimeReg(ins.rd) && ins.rd == ins.rs1 && ins.imm != 0 {
|
||||
ins.as = ACSRAI
|
||||
}
|
||||
|
||||
case AANDI:
|
||||
if isIntPrimeReg(ins.rd) && ins.rd == ins.rs1 && immIFits(ins.imm, 6) == nil {
|
||||
ins.as = ACANDI
|
||||
}
|
||||
|
||||
case AADD:
|
||||
if ins.rd != REG_X0 && ins.rd == ins.rs1 && ins.rs2 != REG_X0 {
|
||||
ins.as = ACADD
|
||||
} else if ins.rd != REG_X0 && ins.rd == ins.rs2 && ins.rs1 != REG_X0 {
|
||||
ins.as, ins.rs1, ins.rs2 = ACADD, ins.rs2, ins.rs1
|
||||
} else if ins.rd != REG_X0 && ins.rs1 == REG_X0 && ins.rs2 != REG_X0 {
|
||||
ins.as = ACMV
|
||||
}
|
||||
|
||||
case AADDW:
|
||||
if isIntPrimeReg(ins.rd) && ins.rd == ins.rs1 && isIntPrimeReg(ins.rs2) {
|
||||
ins.as = ACADDW
|
||||
} else if isIntPrimeReg(ins.rd) && isIntPrimeReg(ins.rs1) && ins.rd == ins.rs2 {
|
||||
ins.as, ins.rs1, ins.rs2 = ACADDW, ins.rs2, ins.rs1
|
||||
}
|
||||
|
||||
case ASUB:
|
||||
if isIntPrimeReg(ins.rd) && ins.rd == ins.rs1 && isIntPrimeReg(ins.rs2) {
|
||||
ins.as = ACSUB
|
||||
}
|
||||
|
||||
case ASUBW:
|
||||
if isIntPrimeReg(ins.rd) && ins.rd == ins.rs1 && isIntPrimeReg(ins.rs2) {
|
||||
ins.as = ACSUBW
|
||||
}
|
||||
|
||||
case AAND:
|
||||
if isIntPrimeReg(ins.rd) && ins.rd == ins.rs1 && isIntPrimeReg(ins.rs2) {
|
||||
ins.as = ACAND
|
||||
} else if isIntPrimeReg(ins.rd) && isIntPrimeReg(ins.rs1) && ins.rd == ins.rs2 {
|
||||
ins.as, ins.rs1, ins.rs2 = ACAND, ins.rs2, ins.rs1
|
||||
}
|
||||
|
||||
case AOR:
|
||||
if isIntPrimeReg(ins.rd) && ins.rd == ins.rs1 && isIntPrimeReg(ins.rs2) {
|
||||
ins.as = ACOR
|
||||
} else if isIntPrimeReg(ins.rd) && isIntPrimeReg(ins.rs1) && ins.rd == ins.rs2 {
|
||||
ins.as, ins.rs1, ins.rs2 = ACOR, ins.rs2, ins.rs1
|
||||
}
|
||||
|
||||
case AXOR:
|
||||
if isIntPrimeReg(ins.rd) && ins.rd == ins.rs1 && isIntPrimeReg(ins.rs2) {
|
||||
ins.as = ACXOR
|
||||
} else if isIntPrimeReg(ins.rd) && isIntPrimeReg(ins.rs1) && ins.rd == ins.rs2 {
|
||||
ins.as, ins.rs1, ins.rs2 = ACXOR, ins.rs2, ins.rs1
|
||||
}
|
||||
|
||||
case AEBREAK:
|
||||
ins.as, ins.rd, ins.rs1 = ACEBREAK, obj.REG_NONE, obj.REG_NONE
|
||||
}
|
||||
}
|
||||
|
||||
// instructionForProg returns the default *obj.Prog to instruction mapping.
|
||||
func instructionForProg(p *obj.Prog) *instruction {
|
||||
ins := &instruction{
|
||||
|
|
@ -4057,7 +4214,7 @@ func instructionsForMinMax(p *obj.Prog, ins *instruction) []*instruction {
|
|||
}
|
||||
|
||||
// instructionsForProg returns the machine instructions for an *obj.Prog.
|
||||
func instructionsForProg(p *obj.Prog) []*instruction {
|
||||
func instructionsForProg(p *obj.Prog, compress bool) []*instruction {
|
||||
ins := instructionForProg(p)
|
||||
inss := []*instruction{ins}
|
||||
|
||||
|
|
@ -4710,6 +4867,15 @@ func instructionsForProg(p *obj.Prog) []*instruction {
|
|||
ins.rs1, ins.rs2 = obj.REG_NONE, REG_V0
|
||||
}
|
||||
|
||||
// Only compress instructions when there is no relocation, since
|
||||
// relocation relies on knowledge about the exact instructions that
|
||||
// are in use.
|
||||
if compress && p.Mark&NEED_RELOC == 0 {
|
||||
for _, ins := range inss {
|
||||
ins.compress()
|
||||
}
|
||||
}
|
||||
|
||||
for _, ins := range inss {
|
||||
ins.p = p
|
||||
}
|
||||
|
|
@ -4799,15 +4965,22 @@ func assemble(ctxt *obj.Link, cursym *obj.LSym, newprog obj.ProgAlloc) {
|
|||
v := pcAlignPadLength(p.Pc, alignedValue)
|
||||
offset := p.Pc
|
||||
for ; v >= 4; v -= 4 {
|
||||
// NOP
|
||||
cursym.WriteBytes(ctxt, offset, []byte{0x13, 0, 0, 0})
|
||||
// NOP (ADDI $0, X0, X0)
|
||||
cursym.WriteBytes(ctxt, offset, []byte{0x13, 0x00, 0x00, 0x00})
|
||||
offset += 4
|
||||
}
|
||||
if v == 2 {
|
||||
// CNOP
|
||||
cursym.WriteBytes(ctxt, offset, []byte{0x01, 0x00})
|
||||
offset += 2
|
||||
} else if v != 0 {
|
||||
ctxt.Diag("bad PCALIGN pad length")
|
||||
}
|
||||
continue
|
||||
}
|
||||
|
||||
offset := p.Pc
|
||||
for _, ins := range instructionsForProg(p) {
|
||||
for _, ins := range instructionsForProg(p, ctxt.CompressInstructions) {
|
||||
if ic, err := ins.encode(); err == nil {
|
||||
cursym.WriteInt(ctxt, offset, ins.length(), int64(ic))
|
||||
offset += int64(ins.length())
|
||||
|
|
|
|||
|
|
@ -423,8 +423,12 @@ func rewriteToUseGot(ctxt *obj.Link, p *obj.Prog, newprog obj.ProgAlloc) {
|
|||
q.From.Reg = reg
|
||||
}
|
||||
}
|
||||
if p.GetFrom3() != nil && p.GetFrom3().Name == obj.NAME_EXTERN {
|
||||
ctxt.Diag("don't know how to handle %v with -dynlink", p)
|
||||
from3 := p.GetFrom3()
|
||||
for i := range p.RestArgs {
|
||||
a := &p.RestArgs[i].Addr
|
||||
if a != from3 && a.Name == obj.NAME_EXTERN && !a.Sym.Local() {
|
||||
ctxt.Diag("don't know how to handle %v with -dynlink", p)
|
||||
}
|
||||
}
|
||||
var source *obj.Addr
|
||||
// MOVx sym, Ry becomes $MOV sym@GOT, R15; MOVx (R15), Ry
|
||||
|
|
@ -434,9 +438,17 @@ func rewriteToUseGot(ctxt *obj.Link, p *obj.Prog, newprog obj.ProgAlloc) {
|
|||
if p.To.Name == obj.NAME_EXTERN && !p.To.Sym.Local() {
|
||||
ctxt.Diag("cannot handle NAME_EXTERN on both sides in %v with -dynlink", p)
|
||||
}
|
||||
if from3 != nil && from3.Name == obj.NAME_EXTERN && !from3.Sym.Local() {
|
||||
ctxt.Diag("cannot handle NAME_EXTERN on multiple operands in %v with -dynlink", p)
|
||||
}
|
||||
source = &p.From
|
||||
} else if p.To.Name == obj.NAME_EXTERN && !p.To.Sym.Local() {
|
||||
if from3 != nil && from3.Name == obj.NAME_EXTERN && !from3.Sym.Local() {
|
||||
ctxt.Diag("cannot handle NAME_EXTERN on multiple operands in %v with -dynlink", p)
|
||||
}
|
||||
source = &p.To
|
||||
} else if from3 != nil && from3.Name == obj.NAME_EXTERN && !from3.Sym.Local() {
|
||||
source = from3
|
||||
} else {
|
||||
return
|
||||
}
|
||||
|
|
@ -501,9 +513,7 @@ func rewriteToUseGot(ctxt *obj.Link, p *obj.Prog, newprog obj.ProgAlloc) {
|
|||
p2.As = p.As
|
||||
p2.From = p.From
|
||||
p2.To = p.To
|
||||
if from3 := p.GetFrom3(); from3 != nil {
|
||||
p2.AddRestSource(*from3)
|
||||
}
|
||||
p2.RestArgs = p.RestArgs
|
||||
if p.From.Name == obj.NAME_EXTERN {
|
||||
p2.From.Reg = reg
|
||||
p2.From.Name = obj.NAME_NONE
|
||||
|
|
@ -512,6 +522,11 @@ func rewriteToUseGot(ctxt *obj.Link, p *obj.Prog, newprog obj.ProgAlloc) {
|
|||
p2.To.Reg = reg
|
||||
p2.To.Name = obj.NAME_NONE
|
||||
p2.To.Sym = nil
|
||||
} else if p.GetFrom3() != nil && p.GetFrom3().Name == obj.NAME_EXTERN {
|
||||
from3 = p2.GetFrom3()
|
||||
from3.Reg = reg
|
||||
from3.Name = obj.NAME_NONE
|
||||
from3.Sym = nil
|
||||
} else {
|
||||
return
|
||||
}
|
||||
|
|
|
|||
|
|
@ -236,7 +236,7 @@ var ArchRISCV64 = &Arch{
|
|||
ByteOrder: binary.LittleEndian,
|
||||
PtrSize: 8,
|
||||
RegSize: 8,
|
||||
MinLC: 4,
|
||||
MinLC: 2,
|
||||
Alignment: 8, // riscv unaligned loads work, but are really slow (trap + simulated by OS)
|
||||
CanMergeLoads: false,
|
||||
HasLR: true,
|
||||
|
|
|
|||
|
|
@ -2507,19 +2507,19 @@ func dwarfcompress(ctxt *Link) {
|
|||
var prevSect *sym.Section
|
||||
for _, si := range dwarfp {
|
||||
for _, s := range si.syms {
|
||||
ldr.SetSymValue(s, int64(pos))
|
||||
sect := ldr.SymSect(s)
|
||||
if sect != prevSect {
|
||||
if ctxt.IsWindows() {
|
||||
pos = uint64(Rnd(int64(pos), PEFILEALIGN))
|
||||
}
|
||||
sect.Vaddr = pos
|
||||
prevSect = sect
|
||||
}
|
||||
ldr.SetSymValue(s, int64(pos))
|
||||
if ldr.SubSym(s) != 0 {
|
||||
log.Fatalf("%s: unexpected sub-symbols", ldr.SymName(s))
|
||||
}
|
||||
pos += uint64(ldr.SymSize(s))
|
||||
if ctxt.IsWindows() {
|
||||
pos = uint64(Rnd(int64(pos), PEFILEALIGN))
|
||||
}
|
||||
}
|
||||
}
|
||||
Segdwarf.Length = pos - Segdwarf.Vaddr
|
||||
|
|
|
|||
|
|
@ -387,7 +387,7 @@ func TestRISCVTrampolines(t *testing.T) {
|
|||
buf := new(bytes.Buffer)
|
||||
fmt.Fprintf(buf, "TEXT a(SB),$0-0\n")
|
||||
for i := 0; i < 1<<17; i++ {
|
||||
fmt.Fprintf(buf, "\tADD $0, X0, X0\n")
|
||||
fmt.Fprintf(buf, "\tADD $0, X5, X0\n")
|
||||
}
|
||||
fmt.Fprintf(buf, "\tCALL b(SB)\n")
|
||||
fmt.Fprintf(buf, "\tRET\n")
|
||||
|
|
@ -398,7 +398,7 @@ func TestRISCVTrampolines(t *testing.T) {
|
|||
fmt.Fprintf(buf, "\tRET\n")
|
||||
fmt.Fprintf(buf, "TEXT ·d(SB),0,$0-0\n")
|
||||
for i := 0; i < 1<<17; i++ {
|
||||
fmt.Fprintf(buf, "\tADD $0, X0, X0\n")
|
||||
fmt.Fprintf(buf, "\tADD $0, X5, X0\n")
|
||||
}
|
||||
fmt.Fprintf(buf, "\tCALL a(SB)\n")
|
||||
fmt.Fprintf(buf, "\tCALL c(SB)\n")
|
||||
|
|
|
|||
|
|
@ -188,7 +188,11 @@ func Main(arch *sys.Arch, theArch Arch) {
|
|||
|
||||
buildVersion := buildcfg.Version
|
||||
if goexperiment := buildcfg.Experiment.String(); goexperiment != "" {
|
||||
buildVersion += " X:" + goexperiment
|
||||
sep := " "
|
||||
if !strings.Contains(buildVersion, "-") { // See go.dev/issue/75953.
|
||||
sep = "-"
|
||||
}
|
||||
buildVersion += sep + "X:" + goexperiment
|
||||
}
|
||||
addstrdata1(ctxt, "runtime.buildVersion="+buildVersion)
|
||||
|
||||
|
|
|
|||
|
|
@ -2464,10 +2464,11 @@ var blockedLinknames = map[string][]string{
|
|||
// Experimental features
|
||||
"runtime.goroutineLeakGC": {"runtime/pprof"},
|
||||
"runtime.goroutineleakcount": {"runtime/pprof"},
|
||||
"runtime.freegc": {}, // disallow all packages
|
||||
// Others
|
||||
"net.newWindowsFile": {"net"}, // pushed from os
|
||||
"testing/synctest.testingSynctestTest": {"testing/synctest"}, // pushed from testing
|
||||
"runtime.addmoduledata": {}, // disallow all package
|
||||
"runtime.addmoduledata": {}, // disallow all packages
|
||||
}
|
||||
|
||||
// check if a linkname reference to symbol s from pkg is allowed
|
||||
|
|
|
|||
|
|
@ -1616,6 +1616,7 @@ func TestCheckLinkname(t *testing.T) {
|
|||
// pull linkname of a builtin symbol is not ok
|
||||
{"builtin.go", false},
|
||||
{"addmoduledata.go", false},
|
||||
{"freegc.go", false},
|
||||
// legacy bad linkname is ok, for now
|
||||
{"fastrand.go", true},
|
||||
{"badlinkname.go", true},
|
||||
|
|
|
|||
18
src/cmd/link/testdata/linkname/freegc.go
vendored
Normal file
18
src/cmd/link/testdata/linkname/freegc.go
vendored
Normal file
|
|
@ -0,0 +1,18 @@
|
|||
// Copyright 2025 The Go Authors. All rights reserved.
|
||||
// Use of this source code is governed by a BSD-style
|
||||
// license that can be found in the LICENSE file.
|
||||
|
||||
// Linkname runtime.freegc is not allowed.
|
||||
|
||||
package main
|
||||
|
||||
import (
|
||||
_ "unsafe"
|
||||
)
|
||||
|
||||
//go:linkname freegc runtime.freegc
|
||||
func freegc()
|
||||
|
||||
func main() {
|
||||
freegc()
|
||||
}
|
||||
|
|
@ -143,6 +143,13 @@ func (g *procGenerator) ProcTransition(ctx *traceContext, ev *trace.Event) {
|
|||
viewerEv := traceviewer.InstantEvent{
|
||||
Resource: uint64(proc),
|
||||
Stack: ctx.Stack(viewerFrames(ev.Stack())),
|
||||
|
||||
// Annotate with the thread and proc. The proc is redundant, but this is to
|
||||
// stay consistent with the thread view, where it's useful information.
|
||||
Arg: format.SchedCtxArg{
|
||||
ProcID: uint64(st.Resource.Proc()),
|
||||
ThreadID: uint64(ev.Thread()),
|
||||
},
|
||||
}
|
||||
|
||||
from, to := st.Proc()
|
||||
|
|
@ -156,7 +163,6 @@ func (g *procGenerator) ProcTransition(ctx *traceContext, ev *trace.Event) {
|
|||
start = ctx.startTime
|
||||
}
|
||||
viewerEv.Name = "proc start"
|
||||
viewerEv.Arg = format.ThreadIDArg{ThreadID: uint64(ev.Thread())}
|
||||
viewerEv.Ts = ctx.elapsed(start)
|
||||
ctx.IncThreadStateCount(ctx.elapsed(start), traceviewer.ThreadStateRunning, 1)
|
||||
}
|
||||
|
|
|
|||
|
|
@ -138,14 +138,17 @@ func (g *threadGenerator) ProcTransition(ctx *traceContext, ev *trace.Event) {
|
|||
}
|
||||
}
|
||||
|
||||
type procArg struct {
|
||||
Proc uint64 `json:"proc,omitempty"`
|
||||
}
|
||||
st := ev.StateTransition()
|
||||
viewerEv := traceviewer.InstantEvent{
|
||||
Resource: uint64(ev.Thread()),
|
||||
Stack: ctx.Stack(viewerFrames(ev.Stack())),
|
||||
Arg: procArg{Proc: uint64(st.Resource.Proc())},
|
||||
|
||||
// Annotate with the thread and proc. The thread is redundant, but this is to
|
||||
// stay consistent with the proc view.
|
||||
Arg: format.SchedCtxArg{
|
||||
ProcID: uint64(st.Resource.Proc()),
|
||||
ThreadID: uint64(ev.Thread()),
|
||||
},
|
||||
}
|
||||
|
||||
from, to := st.Proc()
|
||||
|
|
@ -159,7 +162,6 @@ func (g *threadGenerator) ProcTransition(ctx *traceContext, ev *trace.Event) {
|
|||
start = ctx.startTime
|
||||
}
|
||||
viewerEv.Name = "proc start"
|
||||
viewerEv.Arg = format.ThreadIDArg{ThreadID: uint64(ev.Thread())}
|
||||
viewerEv.Ts = ctx.elapsed(start)
|
||||
// TODO(mknyszek): We don't have a state machine for threads, so approximate
|
||||
// running threads with running Ps.
|
||||
|
|
|
|||
2
src/cmd/vendor/golang.org/x/mod/modfile/print.go
generated
vendored
2
src/cmd/vendor/golang.org/x/mod/modfile/print.go
generated
vendored
|
|
@ -33,7 +33,7 @@ type printer struct {
|
|||
}
|
||||
|
||||
// printf prints to the buffer.
|
||||
func (p *printer) printf(format string, args ...interface{}) {
|
||||
func (p *printer) printf(format string, args ...any) {
|
||||
fmt.Fprintf(p, format, args...)
|
||||
}
|
||||
|
||||
|
|
|
|||
Some files were not shown because too many files have changed in this diff Show more
Loading…
Add table
Add a link
Reference in a new issue